Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3QI89

Protein Details
Accession A0A1E3QI89    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MVNIPKTRRTYCKSKECRKHTQHKVTQYKAGKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTYCKSKECRKHTQHKVTQYKAGKASLYAQGKRRYDRKQRGYGGQTKQVFHKKAKTTKKVVLRLECTVCKTKAQLPLKRCKHFELGGDKKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.85
3 0.85
4 0.89
5 0.88
6 0.89
7 0.89
8 0.9
9 0.87
10 0.87
11 0.88
12 0.81
13 0.8
14 0.74
15 0.69
16 0.61
17 0.55
18 0.44
19 0.35
20 0.34
21 0.33
22 0.34
23 0.32
24 0.35
25 0.41
26 0.44
27 0.48
28 0.53
29 0.54
30 0.59
31 0.66
32 0.69
33 0.7
34 0.71
35 0.73
36 0.72
37 0.71
38 0.64
39 0.61
40 0.54
41 0.45
42 0.47
43 0.47
44 0.44
45 0.39
46 0.43
47 0.43
48 0.5
49 0.6
50 0.62
51 0.61
52 0.65
53 0.71
54 0.71
55 0.7
56 0.68
57 0.62
58 0.59
59 0.57
60 0.52
61 0.48
62 0.45
63 0.39
64 0.33
65 0.32
66 0.32
67 0.37
68 0.44
69 0.47
70 0.5
71 0.6
72 0.68
73 0.72
74 0.7
75 0.65
76 0.63
77 0.59
78 0.59
79 0.59
80 0.59
81 0.61
82 0.66
83 0.62
84 0.6
85 0.61
86 0.57