Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3QBV9

Protein Details
Accession A0A1E3QBV9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-40GGGLRLKGAKIEKKKKKKLHKDKLPTESTTBasic
NLS Segment(s)
PositionSequence
15-32RLKGAKIEKKKKKKLHKD
Subcellular Location(s) nucl 23.5, mito_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MAGDVYANVSGGGLRLKGAKIEKKKKKKLHKDKLPTESTTSSHNDTKVDSTTTENGKSIITEVDNKTDAERKFEEVQRKRLEKILEKKASKSHREEVEEYNKYLSGLTDHNDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.1
4 0.15
5 0.22
6 0.3
7 0.4
8 0.51
9 0.61
10 0.7
11 0.8
12 0.85
13 0.9
14 0.92
15 0.93
16 0.94
17 0.94
18 0.94
19 0.93
20 0.92
21 0.85
22 0.76
23 0.7
24 0.61
25 0.5
26 0.43
27 0.36
28 0.31
29 0.28
30 0.27
31 0.22
32 0.21
33 0.22
34 0.2
35 0.18
36 0.15
37 0.15
38 0.18
39 0.19
40 0.19
41 0.17
42 0.16
43 0.15
44 0.14
45 0.12
46 0.09
47 0.07
48 0.11
49 0.12
50 0.13
51 0.14
52 0.14
53 0.15
54 0.2
55 0.2
56 0.2
57 0.21
58 0.23
59 0.27
60 0.32
61 0.41
62 0.41
63 0.49
64 0.53
65 0.54
66 0.52
67 0.51
68 0.53
69 0.52
70 0.55
71 0.57
72 0.58
73 0.57
74 0.59
75 0.63
76 0.65
77 0.63
78 0.6
79 0.58
80 0.56
81 0.6
82 0.61
83 0.6
84 0.62
85 0.58
86 0.53
87 0.46
88 0.39
89 0.33
90 0.29
91 0.22
92 0.15
93 0.14
94 0.15
95 0.18
96 0.19
97 0.21
98 0.23
99 0.23