Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C7YTS4

Protein Details
Accession C7YTS4    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
104-125ESTTPKSGKKRGRPSKNATESPHydrophilic
NLS Segment(s)
PositionSequence
31-119KRGRGRPRSAAPKPPYVPSGRPRGRPKGSTKASTAKKAALEKAVGLAKKTASTDATGAKRGRGRPRKNAQPEAESTTPKSGKKRGRPSK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
IPR000637  HMGI/Y_DNA-bd_CS  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
KEGG nhe:NECHADRAFT_123405  -  
Pfam View protein in Pfam  
PF02178  AT_hook  
PROSITE View protein in PROSITE  
PS00354  HMGI_Y  
Amino Acid Sequences MARTKEDVVATSPRVAKSSAGVSKDTETPVKRGRGRPRSAAPKPPYVPSGRPRGRPKGSTKASTAKKAALEKAVGLAKKTASTDATGAKRGRGRPRKNAQPEAESTTPKSGKKRGRPSKNATESPAAQDEAEDDNEEPEPVEAAEPVEDANADDESDGDIPTAGQEESADKELPDDDLSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.26
4 0.23
5 0.3
6 0.3
7 0.28
8 0.29
9 0.29
10 0.31
11 0.33
12 0.33
13 0.31
14 0.27
15 0.31
16 0.37
17 0.43
18 0.48
19 0.54
20 0.62
21 0.66
22 0.7
23 0.72
24 0.74
25 0.77
26 0.76
27 0.77
28 0.71
29 0.7
30 0.67
31 0.61
32 0.56
33 0.5
34 0.51
35 0.46
36 0.52
37 0.48
38 0.55
39 0.59
40 0.65
41 0.66
42 0.66
43 0.68
44 0.68
45 0.68
46 0.63
47 0.6
48 0.6
49 0.58
50 0.56
51 0.51
52 0.43
53 0.41
54 0.4
55 0.38
56 0.31
57 0.27
58 0.21
59 0.23
60 0.23
61 0.19
62 0.16
63 0.15
64 0.13
65 0.14
66 0.14
67 0.12
68 0.1
69 0.1
70 0.11
71 0.15
72 0.16
73 0.2
74 0.2
75 0.22
76 0.25
77 0.29
78 0.38
79 0.43
80 0.48
81 0.54
82 0.63
83 0.7
84 0.74
85 0.77
86 0.7
87 0.64
88 0.6
89 0.56
90 0.5
91 0.41
92 0.34
93 0.32
94 0.31
95 0.3
96 0.32
97 0.34
98 0.4
99 0.49
100 0.59
101 0.64
102 0.72
103 0.78
104 0.82
105 0.85
106 0.85
107 0.78
108 0.71
109 0.65
110 0.55
111 0.49
112 0.43
113 0.33
114 0.24
115 0.2
116 0.18
117 0.16
118 0.15
119 0.12
120 0.1
121 0.11
122 0.11
123 0.11
124 0.09
125 0.07
126 0.07
127 0.06
128 0.06
129 0.06
130 0.06
131 0.06
132 0.06
133 0.06
134 0.06
135 0.05
136 0.05
137 0.07
138 0.06
139 0.06
140 0.06
141 0.06
142 0.08
143 0.08
144 0.08
145 0.07
146 0.07
147 0.06
148 0.07
149 0.08
150 0.06
151 0.06
152 0.07
153 0.08
154 0.12
155 0.15
156 0.16
157 0.14
158 0.15
159 0.16
160 0.17