Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3Q0D4

Protein Details
Accession A0A1E3Q0D4   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
125-151IKSRWGLFKRTSRIHRQKRRELWARGEHydrophilic
NLS Segment(s)
PositionSequence
132-145FKRTSRIHRQKRRE
Subcellular Location(s) mito 17, nucl 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR024388  Ribosomal_L20_mt  
Pfam View protein in Pfam  
PF12824  MRP-L20  
Amino Acid Sequences KYNPISSANKAVPILPPGLSYNPPPSTPSPFETPDIFLPPSERRLVPTAEALPVLPPALRETTNKKYHLTPEQLEEMKQLRTAHPYKWTRRSLAKKFGCSQFFVGMVAEAPESRKLDMQRRLAMIKSRWGLFKRTSRIHRQKRRELWARGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.19
3 0.19
4 0.19
5 0.21
6 0.22
7 0.22
8 0.27
9 0.27
10 0.28
11 0.3
12 0.31
13 0.35
14 0.37
15 0.38
16 0.36
17 0.36
18 0.38
19 0.36
20 0.35
21 0.3
22 0.3
23 0.26
24 0.21
25 0.22
26 0.22
27 0.24
28 0.24
29 0.22
30 0.21
31 0.24
32 0.25
33 0.22
34 0.24
35 0.22
36 0.19
37 0.19
38 0.16
39 0.13
40 0.12
41 0.11
42 0.07
43 0.06
44 0.07
45 0.09
46 0.1
47 0.13
48 0.2
49 0.28
50 0.35
51 0.36
52 0.36
53 0.37
54 0.4
55 0.45
56 0.43
57 0.35
58 0.32
59 0.35
60 0.33
61 0.31
62 0.28
63 0.22
64 0.17
65 0.19
66 0.17
67 0.13
68 0.19
69 0.21
70 0.21
71 0.29
72 0.36
73 0.41
74 0.49
75 0.52
76 0.49
77 0.57
78 0.64
79 0.63
80 0.66
81 0.65
82 0.61
83 0.64
84 0.67
85 0.59
86 0.52
87 0.46
88 0.37
89 0.31
90 0.26
91 0.2
92 0.13
93 0.11
94 0.09
95 0.07
96 0.06
97 0.07
98 0.1
99 0.11
100 0.12
101 0.15
102 0.2
103 0.28
104 0.36
105 0.42
106 0.43
107 0.46
108 0.47
109 0.47
110 0.5
111 0.44
112 0.43
113 0.41
114 0.38
115 0.41
116 0.41
117 0.43
118 0.44
119 0.51
120 0.51
121 0.57
122 0.63
123 0.68
124 0.77
125 0.83
126 0.86
127 0.87
128 0.89
129 0.9
130 0.92
131 0.91