Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3BF26

Protein Details
Accession G3BF26    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
105-131DAYTECRRDFFKKKKEDRQKGKGGWGFBasic
NLS Segment(s)
PositionSequence
116-126KKKKEDRQKGK
Subcellular Location(s) nucl 18, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
KEGG cten:CANTEDRAFT_111501  -  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MPEPTKETAKEAPNQSTKPKTINSSEQKPSYDYVETRKDKVDFTKGGVDNYKFYPDNPNSHHHKYNWVNKEPSKFYDPCEQSRQASINCVLRNQDDRSVCQAFFDAYTECRRDFFKKKKEDRQKGKGGWGFWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.58
3 0.58
4 0.56
5 0.53
6 0.52
7 0.49
8 0.48
9 0.55
10 0.56
11 0.57
12 0.61
13 0.6
14 0.57
15 0.53
16 0.48
17 0.41
18 0.36
19 0.3
20 0.29
21 0.36
22 0.37
23 0.37
24 0.4
25 0.37
26 0.36
27 0.39
28 0.39
29 0.31
30 0.31
31 0.38
32 0.34
33 0.35
34 0.37
35 0.33
36 0.28
37 0.28
38 0.29
39 0.2
40 0.2
41 0.27
42 0.25
43 0.3
44 0.31
45 0.36
46 0.39
47 0.44
48 0.47
49 0.39
50 0.45
51 0.47
52 0.53
53 0.54
54 0.52
55 0.51
56 0.5
57 0.55
58 0.49
59 0.45
60 0.41
61 0.34
62 0.33
63 0.38
64 0.39
65 0.38
66 0.41
67 0.4
68 0.35
69 0.38
70 0.38
71 0.28
72 0.29
73 0.27
74 0.27
75 0.25
76 0.26
77 0.24
78 0.24
79 0.28
80 0.27
81 0.3
82 0.26
83 0.29
84 0.34
85 0.35
86 0.32
87 0.27
88 0.25
89 0.19
90 0.18
91 0.17
92 0.12
93 0.12
94 0.18
95 0.2
96 0.19
97 0.2
98 0.24
99 0.3
100 0.39
101 0.47
102 0.52
103 0.6
104 0.71
105 0.8
106 0.88
107 0.92
108 0.92
109 0.92
110 0.92
111 0.87
112 0.86
113 0.8