Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3Q3T2

Protein Details
Accession A0A1E3Q3T2    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20AKKPKRKRIIDPDAPRRPQTBasic
NLS Segment(s)
PositionSequence
2-8KKPKRKR
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences AKKPKRKRIIDPDAPRRPQTVYFAFANEARKLIREEYQAKGIEATNTEIIREVAERWKNMSDEQKEPWKAIYAEQIKRYDEEKAAYNAGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.76
3 0.67
4 0.59
5 0.52
6 0.48
7 0.4
8 0.34
9 0.31
10 0.3
11 0.3
12 0.29
13 0.3
14 0.23
15 0.21
16 0.17
17 0.17
18 0.18
19 0.18
20 0.19
21 0.22
22 0.24
23 0.26
24 0.31
25 0.3
26 0.28
27 0.27
28 0.23
29 0.18
30 0.16
31 0.15
32 0.12
33 0.11
34 0.11
35 0.11
36 0.1
37 0.1
38 0.09
39 0.09
40 0.14
41 0.17
42 0.17
43 0.19
44 0.21
45 0.22
46 0.25
47 0.33
48 0.3
49 0.31
50 0.35
51 0.42
52 0.41
53 0.4
54 0.38
55 0.34
56 0.3
57 0.29
58 0.34
59 0.33
60 0.38
61 0.44
62 0.46
63 0.43
64 0.44
65 0.44
66 0.38
67 0.33
68 0.3
69 0.28
70 0.29