Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QEA1

Protein Details
Accession A0A1E3QEA1   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
163-183YSASGPLRKRRRINNDKLEKEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 4, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024752  Myb/SANT-like_dom  
Pfam View protein in Pfam  
PF12776  Myb_DNA-bind_3  
Amino Acid Sequences MLLRGNNRREIEPADLYLLPLENEGPTKCKVLVILLCNGKTNQHGQHVLSIEKLKSKESNYKAYYKDWKWLIGQSGFAIHPETRCVTAAPEAWDELLRHRKSCKWHRYNALEFTELLDELYAPSMATGGYATTLINRPSDSPLLDPLLRAPSSSGSSSTPSPYSASGPLRKRRRINNDKLEKEEEKEILQGGSYQLIEKVITQLARSRRNVLQQAIDLLEEEYSRKLSSEHMDMALDCLENESKSSMFTSIKDVARRDRWLERHAGVEILSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.28
4 0.26
5 0.22
6 0.16
7 0.13
8 0.12
9 0.09
10 0.12
11 0.13
12 0.15
13 0.16
14 0.18
15 0.18
16 0.19
17 0.18
18 0.22
19 0.26
20 0.26
21 0.32
22 0.34
23 0.35
24 0.36
25 0.35
26 0.31
27 0.28
28 0.31
29 0.28
30 0.3
31 0.33
32 0.31
33 0.37
34 0.37
35 0.35
36 0.33
37 0.32
38 0.26
39 0.28
40 0.28
41 0.26
42 0.28
43 0.32
44 0.39
45 0.4
46 0.49
47 0.47
48 0.53
49 0.53
50 0.55
51 0.59
52 0.51
53 0.54
54 0.46
55 0.45
56 0.4
57 0.41
58 0.4
59 0.31
60 0.3
61 0.23
62 0.23
63 0.2
64 0.19
65 0.18
66 0.13
67 0.12
68 0.13
69 0.14
70 0.13
71 0.13
72 0.13
73 0.12
74 0.15
75 0.17
76 0.17
77 0.16
78 0.15
79 0.15
80 0.16
81 0.15
82 0.18
83 0.26
84 0.24
85 0.25
86 0.27
87 0.31
88 0.4
89 0.5
90 0.55
91 0.54
92 0.61
93 0.68
94 0.73
95 0.75
96 0.72
97 0.64
98 0.54
99 0.46
100 0.39
101 0.31
102 0.22
103 0.16
104 0.09
105 0.06
106 0.05
107 0.06
108 0.04
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.05
120 0.07
121 0.07
122 0.08
123 0.08
124 0.09
125 0.11
126 0.12
127 0.12
128 0.11
129 0.12
130 0.14
131 0.14
132 0.12
133 0.12
134 0.14
135 0.13
136 0.13
137 0.11
138 0.11
139 0.13
140 0.13
141 0.13
142 0.11
143 0.13
144 0.14
145 0.15
146 0.14
147 0.13
148 0.14
149 0.13
150 0.14
151 0.17
152 0.21
153 0.26
154 0.33
155 0.42
156 0.5
157 0.56
158 0.61
159 0.66
160 0.73
161 0.76
162 0.79
163 0.81
164 0.83
165 0.79
166 0.78
167 0.75
168 0.65
169 0.57
170 0.5
171 0.4
172 0.3
173 0.27
174 0.22
175 0.15
176 0.14
177 0.12
178 0.09
179 0.09
180 0.09
181 0.08
182 0.08
183 0.08
184 0.09
185 0.08
186 0.1
187 0.1
188 0.1
189 0.11
190 0.16
191 0.24
192 0.31
193 0.33
194 0.36
195 0.38
196 0.46
197 0.51
198 0.48
199 0.45
200 0.38
201 0.39
202 0.34
203 0.3
204 0.22
205 0.17
206 0.14
207 0.1
208 0.1
209 0.09
210 0.09
211 0.09
212 0.09
213 0.09
214 0.13
215 0.17
216 0.21
217 0.22
218 0.22
219 0.23
220 0.23
221 0.24
222 0.21
223 0.16
224 0.11
225 0.11
226 0.11
227 0.11
228 0.12
229 0.12
230 0.11
231 0.12
232 0.14
233 0.15
234 0.15
235 0.16
236 0.22
237 0.27
238 0.32
239 0.36
240 0.39
241 0.44
242 0.49
243 0.54
244 0.53
245 0.56
246 0.57
247 0.57
248 0.61
249 0.54
250 0.51
251 0.46
252 0.42