Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3Q006

Protein Details
Accession A0A1E3Q006   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
46-72APPNTSRPPGRPHKRRHTTNEFVPRKTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 9.5, cyto 6.5, mito 6
Family & Domain DBs
Amino Acid Sequences MYGRVHVFDGAIAEYLALMPLQLSRYGIHAMPTVDLNPSDSAVLCAPPNTSRPPGRPHKRRHTTNEFVPRKTNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.04
5 0.03
6 0.03
7 0.04
8 0.05
9 0.06
10 0.07
11 0.07
12 0.09
13 0.11
14 0.11
15 0.12
16 0.12
17 0.12
18 0.12
19 0.12
20 0.1
21 0.09
22 0.09
23 0.09
24 0.08
25 0.07
26 0.07
27 0.07
28 0.07
29 0.07
30 0.08
31 0.07
32 0.07
33 0.08
34 0.09
35 0.12
36 0.15
37 0.21
38 0.24
39 0.28
40 0.37
41 0.47
42 0.56
43 0.63
44 0.7
45 0.75
46 0.82
47 0.87
48 0.88
49 0.87
50 0.84
51 0.85
52 0.86
53 0.81
54 0.74