Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3PTX8

Protein Details
Accession A0A1E3PTX8    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
108-128RRCGSCKKTGHDRRNCPKPSNBasic
NLS Segment(s)
PositionSequence
80-86RKGRPKG
Subcellular Location(s) nucl 13.5, mito_nucl 11.5, mito 8.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
IPR007527  Znf_SWIM  
Gene Ontology GO:0043229  C:intracellular organelle  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
PS50966  ZF_SWIM  
Amino Acid Sequences MKKVRQQEKESSWETCDCSAWNRYLLPCSHRIQLGVPISITDVHPRWWVNPKFPPVNVFFQHIDAEVLLHLKDPAAALPRKGRPKGTRRLQTSAEVVQKMTDRVEKVRRCGSCKKTGHDRRNCPKPSNNLITTENEATAKDKEPSTMQQASVMDEVNSQMMNPLMGTITIIATKNSRRCGLTYRPFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.38
3 0.33
4 0.26
5 0.27
6 0.28
7 0.26
8 0.26
9 0.26
10 0.26
11 0.3
12 0.32
13 0.32
14 0.34
15 0.35
16 0.36
17 0.34
18 0.33
19 0.3
20 0.34
21 0.33
22 0.27
23 0.24
24 0.21
25 0.2
26 0.2
27 0.19
28 0.16
29 0.14
30 0.15
31 0.18
32 0.19
33 0.21
34 0.31
35 0.33
36 0.35
37 0.41
38 0.47
39 0.48
40 0.48
41 0.48
42 0.43
43 0.46
44 0.4
45 0.38
46 0.31
47 0.29
48 0.28
49 0.24
50 0.2
51 0.13
52 0.12
53 0.08
54 0.07
55 0.06
56 0.06
57 0.05
58 0.05
59 0.05
60 0.05
61 0.06
62 0.11
63 0.12
64 0.13
65 0.19
66 0.26
67 0.32
68 0.34
69 0.4
70 0.43
71 0.51
72 0.6
73 0.63
74 0.66
75 0.64
76 0.67
77 0.62
78 0.56
79 0.51
80 0.45
81 0.39
82 0.3
83 0.25
84 0.22
85 0.2
86 0.18
87 0.16
88 0.14
89 0.12
90 0.16
91 0.25
92 0.27
93 0.3
94 0.37
95 0.38
96 0.42
97 0.5
98 0.52
99 0.53
100 0.55
101 0.56
102 0.61
103 0.69
104 0.73
105 0.74
106 0.78
107 0.77
108 0.83
109 0.82
110 0.77
111 0.73
112 0.72
113 0.7
114 0.68
115 0.6
116 0.54
117 0.52
118 0.49
119 0.46
120 0.38
121 0.3
122 0.22
123 0.21
124 0.19
125 0.18
126 0.17
127 0.16
128 0.15
129 0.16
130 0.19
131 0.22
132 0.27
133 0.28
134 0.26
135 0.28
136 0.28
137 0.29
138 0.27
139 0.24
140 0.17
141 0.14
142 0.14
143 0.11
144 0.1
145 0.08
146 0.08
147 0.07
148 0.07
149 0.06
150 0.06
151 0.06
152 0.06
153 0.06
154 0.06
155 0.06
156 0.09
157 0.1
158 0.1
159 0.15
160 0.22
161 0.28
162 0.33
163 0.36
164 0.36
165 0.39
166 0.45
167 0.52