Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QCW1

Protein Details
Accession A0A1E3QCW1   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
188-211TYDSELPRPKKDKEKKRGLFGRKKBasic
NLS Segment(s)
PositionSequence
195-211RPKKDKEKKRGLFGRKK
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR018809  DUF2406  
Pfam View protein in Pfam  
PF10295  DUF2406  
Amino Acid Sequences MPSFLRRSSTSGSAGSASGQENRRSRLNSLSAKITPEERDRMKQRTANIADPILTAMREEQPYEVSAAHLGEHSSVSPEMHMRDMFGNVIEDPDRSNPTRSRNERPLDTIRSFEYAATGDKHLKEQIFRERLPWEGRRYQPTYNASAYGDDTYDHVGADHYAPPPVVAASSVSSAPRPTIQLGNSGETYDSELPRPKKDKEKKRGLFGRKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.23
3 0.2
4 0.17
5 0.2
6 0.24
7 0.3
8 0.33
9 0.36
10 0.42
11 0.43
12 0.43
13 0.45
14 0.49
15 0.49
16 0.48
17 0.51
18 0.46
19 0.45
20 0.44
21 0.4
22 0.36
23 0.33
24 0.37
25 0.36
26 0.43
27 0.47
28 0.51
29 0.55
30 0.54
31 0.53
32 0.56
33 0.56
34 0.51
35 0.48
36 0.43
37 0.36
38 0.33
39 0.3
40 0.2
41 0.15
42 0.1
43 0.09
44 0.12
45 0.12
46 0.13
47 0.12
48 0.13
49 0.13
50 0.14
51 0.12
52 0.09
53 0.09
54 0.09
55 0.08
56 0.08
57 0.07
58 0.07
59 0.07
60 0.06
61 0.07
62 0.07
63 0.07
64 0.07
65 0.09
66 0.09
67 0.11
68 0.11
69 0.1
70 0.1
71 0.11
72 0.11
73 0.09
74 0.09
75 0.07
76 0.08
77 0.07
78 0.07
79 0.07
80 0.09
81 0.12
82 0.12
83 0.16
84 0.19
85 0.25
86 0.35
87 0.4
88 0.45
89 0.5
90 0.53
91 0.51
92 0.53
93 0.52
94 0.48
95 0.44
96 0.38
97 0.3
98 0.28
99 0.27
100 0.21
101 0.16
102 0.11
103 0.11
104 0.11
105 0.12
106 0.12
107 0.12
108 0.14
109 0.16
110 0.16
111 0.16
112 0.2
113 0.28
114 0.3
115 0.3
116 0.32
117 0.3
118 0.33
119 0.37
120 0.38
121 0.34
122 0.37
123 0.41
124 0.45
125 0.48
126 0.47
127 0.48
128 0.47
129 0.46
130 0.39
131 0.36
132 0.3
133 0.27
134 0.26
135 0.19
136 0.15
137 0.11
138 0.1
139 0.11
140 0.1
141 0.09
142 0.08
143 0.08
144 0.08
145 0.1
146 0.12
147 0.1
148 0.11
149 0.11
150 0.1
151 0.11
152 0.1
153 0.08
154 0.06
155 0.07
156 0.08
157 0.09
158 0.1
159 0.1
160 0.11
161 0.12
162 0.13
163 0.13
164 0.14
165 0.16
166 0.2
167 0.2
168 0.27
169 0.29
170 0.31
171 0.29
172 0.28
173 0.25
174 0.21
175 0.25
176 0.22
177 0.21
178 0.21
179 0.29
180 0.32
181 0.41
182 0.46
183 0.48
184 0.55
185 0.65
186 0.72
187 0.75
188 0.83
189 0.82
190 0.87
191 0.9