Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3PWK9

Protein Details
Accession A0A1E3PWK9    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
14-40AASAGGKKTKKKWSKGKVKDKAQHAVTHydrophilic
NLS Segment(s)
PositionSequence
17-34AGGKKTKKKWSKGKVKDK
Subcellular Location(s) mito 16.5, mito_nucl 12.5, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPAKQSKAQISAAASAGGKKTKKKWSKGKVKDKAQHAVTLDQPTYDKLIKDVSTYKLVTVSVLVDRMKVSGSVARAALRELEARGTIKQVVGHSKQLTYTRAVAVADE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.24
3 0.19
4 0.2
5 0.22
6 0.23
7 0.26
8 0.33
9 0.43
10 0.52
11 0.6
12 0.69
13 0.74
14 0.82
15 0.87
16 0.9
17 0.9
18 0.91
19 0.88
20 0.84
21 0.81
22 0.71
23 0.64
24 0.55
25 0.47
26 0.4
27 0.36
28 0.3
29 0.22
30 0.21
31 0.17
32 0.18
33 0.16
34 0.13
35 0.1
36 0.13
37 0.13
38 0.15
39 0.17
40 0.16
41 0.19
42 0.19
43 0.18
44 0.16
45 0.16
46 0.14
47 0.11
48 0.1
49 0.07
50 0.09
51 0.09
52 0.08
53 0.08
54 0.09
55 0.09
56 0.08
57 0.08
58 0.09
59 0.1
60 0.11
61 0.12
62 0.13
63 0.13
64 0.13
65 0.13
66 0.12
67 0.12
68 0.11
69 0.12
70 0.12
71 0.14
72 0.14
73 0.15
74 0.15
75 0.14
76 0.17
77 0.18
78 0.25
79 0.26
80 0.33
81 0.33
82 0.33
83 0.36
84 0.38
85 0.37
86 0.33
87 0.32
88 0.27
89 0.27