Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QAQ4

Protein Details
Accession A0A1E3QAQ4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-21KTVKKAAKSKHIKRGVKEVVBasic
NLS Segment(s)
PositionSequence
5-26KKAAKSKHIKRGVKEVVKSLRK
Subcellular Location(s) cyto 17, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR029064  L30e-like  
IPR004038  Ribosomal_L7Ae/L30e/S12e/Gad45  
IPR018492  Ribosomal_L7Ae/L8/Nhp2  
IPR004037  Ribosomal_L7Ae_CS  
IPR000948  Ribosomal_L7Ae_prok  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006364  P:rRNA processing  
GO:0006412  P:translation  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF01248  Ribosomal_L7Ae  
PROSITE View protein in PROSITE  
PS01082  RIBOSOMAL_L7AE  
Amino Acid Sequences MKTVKKAAKSKHIKRGVKEVVKSLRKGDKGLVVIAGDISPADVISHIPVLCEDNSVPYLFVPSKEDLGSAGATKRPTSCVMVIPGGFKKDKTDGKDADYKEGFDDIVKEIKALE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.8
3 0.79
4 0.76
5 0.7
6 0.67
7 0.67
8 0.66
9 0.64
10 0.59
11 0.57
12 0.5
13 0.49
14 0.44
15 0.39
16 0.35
17 0.34
18 0.28
19 0.2
20 0.18
21 0.17
22 0.13
23 0.07
24 0.05
25 0.05
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.04
32 0.06
33 0.06
34 0.06
35 0.06
36 0.08
37 0.08
38 0.09
39 0.08
40 0.08
41 0.09
42 0.09
43 0.09
44 0.07
45 0.09
46 0.08
47 0.09
48 0.1
49 0.1
50 0.11
51 0.11
52 0.11
53 0.1
54 0.11
55 0.11
56 0.09
57 0.09
58 0.1
59 0.11
60 0.12
61 0.12
62 0.13
63 0.15
64 0.18
65 0.18
66 0.19
67 0.21
68 0.22
69 0.22
70 0.23
71 0.23
72 0.23
73 0.22
74 0.19
75 0.2
76 0.26
77 0.31
78 0.34
79 0.4
80 0.4
81 0.45
82 0.52
83 0.5
84 0.51
85 0.46
86 0.41
87 0.34
88 0.32
89 0.27
90 0.2
91 0.2
92 0.14
93 0.18
94 0.17