Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3Q682

Protein Details
Accession A0A1E3Q682   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
73-109GQATKVEKPSRQQRKQRKNRDKKTRGTGKKVSKRNKDBasic
NLS Segment(s)
PositionSequence
79-109EKPSRQQRKQRKNRDKKTRGTGKKVSKRNKD
Subcellular Location(s) nucl 11.5cyto_nucl 11.5, cyto 8.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MVVDVLHPSRANVSKDEIRERLATLYKTEKDSVSVFGFRTQFGGGKSTGFALIYDSVDDLKKFEPAYRLVRIGQATKVEKPSRQQRKQRKNRDKKTRGTGKKVSKRNKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.4
3 0.46
4 0.41
5 0.39
6 0.38
7 0.37
8 0.34
9 0.33
10 0.29
11 0.26
12 0.31
13 0.31
14 0.33
15 0.33
16 0.29
17 0.27
18 0.27
19 0.27
20 0.22
21 0.21
22 0.19
23 0.21
24 0.22
25 0.19
26 0.19
27 0.16
28 0.15
29 0.14
30 0.16
31 0.11
32 0.11
33 0.11
34 0.1
35 0.1
36 0.08
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.06
43 0.07
44 0.07
45 0.07
46 0.07
47 0.06
48 0.08
49 0.08
50 0.1
51 0.13
52 0.17
53 0.22
54 0.23
55 0.25
56 0.24
57 0.27
58 0.27
59 0.26
60 0.24
61 0.25
62 0.25
63 0.27
64 0.34
65 0.33
66 0.34
67 0.41
68 0.49
69 0.54
70 0.62
71 0.69
72 0.73
73 0.81
74 0.9
75 0.93
76 0.94
77 0.94
78 0.95
79 0.96
80 0.94
81 0.93
82 0.93
83 0.92
84 0.91
85 0.89
86 0.88
87 0.88
88 0.88
89 0.88