Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3PZ80

Protein Details
Accession A0A1E3PZ80    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MPPKDVGARRHRRKRQRKSRTEDFSDSSBasic
NLS Segment(s)
PositionSequence
7-20GARRHRRKRQRKSR
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MPPKDVGARRHRRKRQRKSRTEDFSDSSPSDSDTGDQVQEQDKEEHDYAEPEEDEVSLLCLSLIEMMMCLTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.94
3 0.95
4 0.94
5 0.93
6 0.93
7 0.91
8 0.87
9 0.81
10 0.73
11 0.63
12 0.57
13 0.48
14 0.38
15 0.29
16 0.22
17 0.18
18 0.14
19 0.13
20 0.09
21 0.1
22 0.09
23 0.08
24 0.08
25 0.1
26 0.11
27 0.12
28 0.12
29 0.12
30 0.16
31 0.17
32 0.17
33 0.15
34 0.15
35 0.14
36 0.16
37 0.15
38 0.11
39 0.11
40 0.1
41 0.09
42 0.08
43 0.09
44 0.06
45 0.06
46 0.05
47 0.05
48 0.05
49 0.06
50 0.06
51 0.04
52 0.05