Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QBK1

Protein Details
Accession A0A1E3QBK1   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
125-149VGPPNTRRPPGRPHKKRVRTEDVGIBasic
NLS Segment(s)
PositionSequence
131-144RRPPGRPHKKRVRT
Subcellular Location(s) cysk 11, cyto 9.5, cyto_nucl 7, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006564  Znf_PMZ  
IPR007527  Znf_SWIM  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF04434  SWIM  
PROSITE View protein in PROSITE  
PS50966  ZF_SWIM  
Amino Acid Sequences MPVQIGDNFPDKGAFMFTMKEIAIKEGYQFTVPYSAVYPHEYEVRTPGGESFPVYLNSRSCPCRRWTYTGVPCAHAVAAISFAGGDYVDFVDDYLKVDAFERTCARGIHAMSTVIVTEDDDLPHVGPPNTRRPPGRPHKKRVRTEDVGIAKKRVKVTCGLMPQATWA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.11
3 0.12
4 0.13
5 0.15
6 0.14
7 0.16
8 0.14
9 0.15
10 0.16
11 0.14
12 0.16
13 0.16
14 0.17
15 0.16
16 0.16
17 0.14
18 0.16
19 0.16
20 0.15
21 0.14
22 0.15
23 0.16
24 0.18
25 0.18
26 0.15
27 0.19
28 0.19
29 0.18
30 0.19
31 0.19
32 0.17
33 0.16
34 0.16
35 0.13
36 0.13
37 0.14
38 0.12
39 0.12
40 0.14
41 0.15
42 0.16
43 0.16
44 0.18
45 0.21
46 0.24
47 0.24
48 0.26
49 0.29
50 0.36
51 0.39
52 0.44
53 0.46
54 0.52
55 0.57
56 0.6
57 0.57
58 0.49
59 0.45
60 0.38
61 0.32
62 0.22
63 0.15
64 0.07
65 0.06
66 0.05
67 0.04
68 0.04
69 0.03
70 0.03
71 0.03
72 0.03
73 0.02
74 0.03
75 0.03
76 0.03
77 0.03
78 0.04
79 0.04
80 0.05
81 0.05
82 0.05
83 0.06
84 0.07
85 0.09
86 0.09
87 0.12
88 0.12
89 0.13
90 0.16
91 0.15
92 0.16
93 0.19
94 0.19
95 0.18
96 0.17
97 0.16
98 0.14
99 0.14
100 0.12
101 0.09
102 0.08
103 0.06
104 0.06
105 0.07
106 0.07
107 0.07
108 0.08
109 0.08
110 0.09
111 0.11
112 0.11
113 0.14
114 0.18
115 0.28
116 0.33
117 0.38
118 0.41
119 0.43
120 0.54
121 0.61
122 0.68
123 0.68
124 0.73
125 0.8
126 0.87
127 0.91
128 0.9
129 0.89
130 0.84
131 0.78
132 0.77
133 0.74
134 0.72
135 0.65
136 0.61
137 0.55
138 0.53
139 0.55
140 0.49
141 0.42
142 0.4
143 0.44
144 0.47
145 0.5
146 0.49
147 0.43