Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3PYF5

Protein Details
Accession A0A1E3PYF5    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-26DLPKNGKFRRWKKVSFDDIDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9, pero 7, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039993  NDUFB10  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0070469  C:respirasome  
Amino Acid Sequences MPFIDHDLPKNGKFRRWKKVSFDDIDYNDPVQLRAAQESELQHQWVKQYALRVVRDALNLCYETRGVNANEDCRDLALKYLEMLPTHRLHGYAGIQRNDPSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.63
3 0.68
4 0.71
5 0.72
6 0.79
7 0.8
8 0.74
9 0.71
10 0.67
11 0.62
12 0.57
13 0.49
14 0.4
15 0.32
16 0.27
17 0.21
18 0.15
19 0.14
20 0.11
21 0.11
22 0.12
23 0.11
24 0.14
25 0.15
26 0.17
27 0.16
28 0.16
29 0.15
30 0.15
31 0.16
32 0.16
33 0.16
34 0.13
35 0.15
36 0.18
37 0.23
38 0.23
39 0.22
40 0.21
41 0.21
42 0.21
43 0.2
44 0.17
45 0.14
46 0.14
47 0.13
48 0.12
49 0.11
50 0.1
51 0.1
52 0.12
53 0.11
54 0.15
55 0.17
56 0.2
57 0.2
58 0.21
59 0.21
60 0.17
61 0.18
62 0.14
63 0.15
64 0.13
65 0.12
66 0.12
67 0.14
68 0.15
69 0.15
70 0.17
71 0.19
72 0.19
73 0.21
74 0.21
75 0.19
76 0.18
77 0.22
78 0.25
79 0.28
80 0.34
81 0.35
82 0.36