Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3QF82

Protein Details
Accession A0A1E3QF82    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
23-42PPNTCRPPGRLNKKRVRTEDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12.833, nucl 12.5, cyto 10, cyto_mito 7.499
Family & Domain DBs
Amino Acid Sequences MHEESRHVSTVIVTKDHLPNVRPPNTCRPPGRLNKKRVRTEDIGIARKGWHAVDATSNLDGSTCREPLEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.29
4 0.3
5 0.25
6 0.32
7 0.39
8 0.46
9 0.44
10 0.46
11 0.52
12 0.55
13 0.6
14 0.54
15 0.52
16 0.54
17 0.61
18 0.68
19 0.65
20 0.7
21 0.72
22 0.79
23 0.8
24 0.76
25 0.73
26 0.66
27 0.6
28 0.58
29 0.56
30 0.51
31 0.43
32 0.39
33 0.32
34 0.29
35 0.27
36 0.19
37 0.14
38 0.1
39 0.11
40 0.14
41 0.16
42 0.17
43 0.17
44 0.16
45 0.14
46 0.14
47 0.13
48 0.14
49 0.16
50 0.15