Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3Q2W8

Protein Details
Accession A0A1E3Q2W8    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
76-98TQSVWGRNARRRQKERIKEIEKAHydrophilic
NLS Segment(s)
PositionSequence
84-101ARRRQKERIKEIEKAYRR
Subcellular Location(s) cyto 12.5, nucl 9, cyto_mito 8.5, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MAIKIFDNLKDYTLKDYFPMFIVVAGYLLFRPYLMKLGGELQKREHRKVNERARAEAAAKVIAPPPPDEQFNEESTQSVWGRNARRRQKERIKEIEKAYRRKAEMEAEDESDKEIEDLLTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.23
4 0.22
5 0.2
6 0.21
7 0.14
8 0.13
9 0.13
10 0.11
11 0.09
12 0.08
13 0.08
14 0.06
15 0.06
16 0.05
17 0.05
18 0.06
19 0.06
20 0.09
21 0.09
22 0.09
23 0.1
24 0.16
25 0.22
26 0.24
27 0.24
28 0.26
29 0.34
30 0.38
31 0.41
32 0.43
33 0.44
34 0.5
35 0.59
36 0.64
37 0.65
38 0.63
39 0.61
40 0.56
41 0.52
42 0.43
43 0.35
44 0.25
45 0.16
46 0.14
47 0.12
48 0.11
49 0.11
50 0.1
51 0.11
52 0.13
53 0.14
54 0.15
55 0.15
56 0.18
57 0.19
58 0.21
59 0.2
60 0.18
61 0.17
62 0.16
63 0.19
64 0.16
65 0.14
66 0.14
67 0.18
68 0.25
69 0.32
70 0.42
71 0.48
72 0.58
73 0.64
74 0.72
75 0.78
76 0.81
77 0.84
78 0.85
79 0.81
80 0.77
81 0.78
82 0.78
83 0.75
84 0.73
85 0.71
86 0.67
87 0.63
88 0.59
89 0.56
90 0.54
91 0.5
92 0.47
93 0.42
94 0.38
95 0.37
96 0.35
97 0.32
98 0.23
99 0.19
100 0.14
101 0.12