Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3QGB0

Protein Details
Accession A0A1E3QGB0    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
96-117LRESLIKRSKRTPQRSPRRDFRBasic
NLS Segment(s)
PositionSequence
102-114KRSKRTPQRSPRR
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR013170  mRNA_splic_Cwf21_dom  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08312  cwf21  
CDD cd21372  cwf21_CWC21-like  
Amino Acid Sequences MSYNNIGLPTPRGSGTSGYITRNVSHIKPRGPPVKPGKDFEDASDLARDAWRKEPAKEIVEHDLKRQIEVKCMELRDQLEDEGADEEEIEKRVEYLRESLIKRSKRTPQRSPRRDFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.25
4 0.25
5 0.25
6 0.28
7 0.28
8 0.27
9 0.28
10 0.29
11 0.24
12 0.3
13 0.34
14 0.35
15 0.39
16 0.46
17 0.52
18 0.5
19 0.57
20 0.58
21 0.64
22 0.63
23 0.61
24 0.58
25 0.55
26 0.53
27 0.45
28 0.4
29 0.3
30 0.27
31 0.24
32 0.2
33 0.14
34 0.16
35 0.15
36 0.11
37 0.15
38 0.21
39 0.22
40 0.23
41 0.29
42 0.31
43 0.33
44 0.33
45 0.31
46 0.3
47 0.34
48 0.34
49 0.29
50 0.31
51 0.28
52 0.28
53 0.31
54 0.25
55 0.25
56 0.26
57 0.28
58 0.26
59 0.27
60 0.27
61 0.25
62 0.26
63 0.22
64 0.22
65 0.19
66 0.15
67 0.14
68 0.13
69 0.11
70 0.1
71 0.07
72 0.06
73 0.07
74 0.08
75 0.09
76 0.09
77 0.07
78 0.08
79 0.11
80 0.12
81 0.14
82 0.15
83 0.2
84 0.27
85 0.29
86 0.37
87 0.43
88 0.48
89 0.51
90 0.56
91 0.61
92 0.65
93 0.73
94 0.75
95 0.78
96 0.83
97 0.88