Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3QFA0

Protein Details
Accession A0A1E3QFA0    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
20-41IHDIKRRQKRSASKHRSIQRTEBasic
NLS Segment(s)
PositionSequence
26-29RQKR
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010997  HRDC-like_sf  
IPR006590  RNA_pol_Rpb4/RPC9_core  
IPR005574  Rpb4/RPC9  
IPR038324  Rpb4/RPC9_sf  
IPR038846  RPC9  
Gene Ontology GO:0005666  C:RNA polymerase III complex  
GO:0000166  F:nucleotide binding  
GO:0006384  P:transcription initiation at RNA polymerase III promoter  
Pfam View protein in Pfam  
PF03874  RNA_pol_Rpb4  
Amino Acid Sequences MKVENPRDKLLSNYEVLEHIHDIKRRQKRSASKHRSIQRTENLETILLELQGYLKGTPAAKQTPEDIRKFLQEISVYELEKAEKLQLLNVAPGSEAALHSLIEECDQRFTGEQRQHMVALVSQFLKPEIQGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.26
4 0.24
5 0.19
6 0.19
7 0.22
8 0.25
9 0.3
10 0.37
11 0.47
12 0.49
13 0.54
14 0.59
15 0.65
16 0.72
17 0.78
18 0.79
19 0.78
20 0.82
21 0.84
22 0.83
23 0.78
24 0.75
25 0.72
26 0.68
27 0.62
28 0.55
29 0.47
30 0.38
31 0.33
32 0.26
33 0.18
34 0.11
35 0.08
36 0.06
37 0.06
38 0.06
39 0.07
40 0.05
41 0.05
42 0.07
43 0.07
44 0.09
45 0.12
46 0.14
47 0.14
48 0.15
49 0.18
50 0.25
51 0.3
52 0.29
53 0.28
54 0.26
55 0.27
56 0.27
57 0.24
58 0.18
59 0.14
60 0.14
61 0.18
62 0.19
63 0.18
64 0.17
65 0.17
66 0.15
67 0.14
68 0.13
69 0.09
70 0.08
71 0.08
72 0.09
73 0.12
74 0.12
75 0.13
76 0.13
77 0.12
78 0.1
79 0.1
80 0.09
81 0.07
82 0.06
83 0.06
84 0.07
85 0.06
86 0.07
87 0.08
88 0.07
89 0.08
90 0.1
91 0.1
92 0.11
93 0.12
94 0.13
95 0.14
96 0.17
97 0.24
98 0.28
99 0.31
100 0.33
101 0.34
102 0.34
103 0.33
104 0.31
105 0.24
106 0.21
107 0.2
108 0.18
109 0.16
110 0.16
111 0.16
112 0.16