Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3Q286

Protein Details
Accession A0A1E3Q286    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
23-55IKDPLLRRRIQNRVAQRARRRRLAKDKEHHAAPBasic
NLS Segment(s)
PositionSequence
29-53RRRIQNRVAQRARRRRLAKDKEHHA
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR021833  DUF3425  
Pfam View protein in Pfam  
PF11905  DUF3425  
Amino Acid Sequences MTSMSPSDIDEMTLEERKEWMGIKDPLLRRRIQNRVAQRARRRRLAKDKEHHAAPAPSVKKSTSSYSPASLPRSSSQSSARSSSTASSATSDCGSVTSESNSPPALADIESSLSSFNINPELFPRSQVVATPQQIQREHYQQELRRQQDDKSQEPQEEQLRQLSLPTRLLLPCQQVGPAMCHNITKLPLTHDLPRFQVFVLPQSSDPMNIPPSLYPTQLQGIIPHIQYVDAIPFASLRDSLLLQLHSGGFDEIEFCSDLLDDGFRVWGNDPTQPMAWEITEEFAKKWRWLMDDTILDIAKFWSGQRQLTTIGAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.18
4 0.18
5 0.2
6 0.2
7 0.19
8 0.23
9 0.26
10 0.31
11 0.39
12 0.45
13 0.5
14 0.53
15 0.54
16 0.54
17 0.6
18 0.65
19 0.63
20 0.66
21 0.69
22 0.75
23 0.81
24 0.82
25 0.83
26 0.85
27 0.85
28 0.86
29 0.82
30 0.81
31 0.83
32 0.84
33 0.84
34 0.83
35 0.84
36 0.81
37 0.77
38 0.68
39 0.62
40 0.54
41 0.45
42 0.45
43 0.38
44 0.33
45 0.33
46 0.31
47 0.3
48 0.3
49 0.33
50 0.3
51 0.33
52 0.34
53 0.35
54 0.39
55 0.39
56 0.41
57 0.37
58 0.34
59 0.31
60 0.34
61 0.33
62 0.32
63 0.32
64 0.33
65 0.35
66 0.35
67 0.33
68 0.28
69 0.28
70 0.26
71 0.22
72 0.18
73 0.15
74 0.15
75 0.14
76 0.15
77 0.14
78 0.13
79 0.1
80 0.1
81 0.11
82 0.09
83 0.1
84 0.11
85 0.12
86 0.12
87 0.14
88 0.13
89 0.12
90 0.11
91 0.1
92 0.09
93 0.08
94 0.07
95 0.07
96 0.08
97 0.08
98 0.08
99 0.07
100 0.06
101 0.07
102 0.07
103 0.07
104 0.1
105 0.1
106 0.1
107 0.12
108 0.16
109 0.15
110 0.17
111 0.17
112 0.15
113 0.15
114 0.15
115 0.18
116 0.2
117 0.22
118 0.26
119 0.26
120 0.3
121 0.31
122 0.33
123 0.32
124 0.32
125 0.31
126 0.29
127 0.34
128 0.33
129 0.41
130 0.47
131 0.46
132 0.44
133 0.44
134 0.41
135 0.42
136 0.44
137 0.38
138 0.37
139 0.36
140 0.32
141 0.32
142 0.34
143 0.32
144 0.28
145 0.25
146 0.21
147 0.19
148 0.18
149 0.18
150 0.17
151 0.15
152 0.14
153 0.13
154 0.13
155 0.13
156 0.15
157 0.16
158 0.16
159 0.15
160 0.14
161 0.14
162 0.13
163 0.14
164 0.15
165 0.14
166 0.13
167 0.12
168 0.12
169 0.13
170 0.13
171 0.14
172 0.12
173 0.12
174 0.14
175 0.18
176 0.2
177 0.27
178 0.29
179 0.3
180 0.31
181 0.31
182 0.28
183 0.24
184 0.24
185 0.18
186 0.18
187 0.18
188 0.16
189 0.15
190 0.17
191 0.17
192 0.15
193 0.15
194 0.13
195 0.13
196 0.12
197 0.13
198 0.11
199 0.17
200 0.17
201 0.18
202 0.16
203 0.16
204 0.18
205 0.19
206 0.19
207 0.14
208 0.16
209 0.18
210 0.17
211 0.16
212 0.14
213 0.12
214 0.12
215 0.12
216 0.1
217 0.07
218 0.07
219 0.06
220 0.06
221 0.07
222 0.08
223 0.07
224 0.06
225 0.07
226 0.08
227 0.09
228 0.11
229 0.11
230 0.1
231 0.12
232 0.12
233 0.1
234 0.11
235 0.09
236 0.07
237 0.06
238 0.07
239 0.06
240 0.07
241 0.08
242 0.07
243 0.07
244 0.07
245 0.07
246 0.07
247 0.07
248 0.06
249 0.06
250 0.07
251 0.07
252 0.08
253 0.1
254 0.14
255 0.15
256 0.19
257 0.2
258 0.22
259 0.23
260 0.23
261 0.23
262 0.2
263 0.18
264 0.16
265 0.15
266 0.14
267 0.16
268 0.16
269 0.16
270 0.2
271 0.24
272 0.23
273 0.27
274 0.29
275 0.3
276 0.33
277 0.37
278 0.39
279 0.39
280 0.39
281 0.39
282 0.34
283 0.3
284 0.28
285 0.23
286 0.16
287 0.13
288 0.12
289 0.17
290 0.2
291 0.24
292 0.26
293 0.28
294 0.3
295 0.3