Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QC65

Protein Details
Accession A0A1E3QC65    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
59-85CKPFIKTESSKRFKKRLRSSPKVYAIVHydrophilic
NLS Segment(s)
PositionSequence
71-74FKKR
Subcellular Location(s) mito 18, cyto 4.5, cyto_nucl 4.5, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MTDCQGIVRSHKRPFLARPSNDAPLLLGERTLAEIGVTVSLRTEENGRNKWQYDLDVGCKPFIKTESSKRFKKRLRSSPKVYAIVAFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.59
3 0.61
4 0.56
5 0.58
6 0.59
7 0.59
8 0.53
9 0.46
10 0.35
11 0.27
12 0.26
13 0.18
14 0.13
15 0.09
16 0.09
17 0.09
18 0.09
19 0.06
20 0.04
21 0.04
22 0.05
23 0.06
24 0.06
25 0.04
26 0.05
27 0.05
28 0.06
29 0.06
30 0.08
31 0.12
32 0.18
33 0.21
34 0.24
35 0.26
36 0.27
37 0.28
38 0.27
39 0.24
40 0.22
41 0.21
42 0.22
43 0.24
44 0.24
45 0.24
46 0.24
47 0.23
48 0.21
49 0.2
50 0.22
51 0.23
52 0.33
53 0.43
54 0.5
55 0.58
56 0.64
57 0.73
58 0.75
59 0.8
60 0.8
61 0.8
62 0.83
63 0.85
64 0.86
65 0.86
66 0.87
67 0.8
68 0.7