Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3QFR6

Protein Details
Accession A0A1E3QFR6    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGKRKKSTRKPQGPRKRDPLPTVFBasic
NLS Segment(s)
PositionSequence
3-17KRKKSTRKPQGPRKR
Subcellular Location(s) nucl 17.5, mito_nucl 12.333, mito 6, cyto_mito 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSTRKPQGPRKRDPLPTVFSCLFCNHEKSVVCRIDKKLKLGFLNCKVCGQNFQTPTNSLSVPVDIYSEWIDACESGELPEKNQDTGDVESDLDDENEPEGEEDDIALE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.9
3 0.88
4 0.85
5 0.81
6 0.77
7 0.73
8 0.66
9 0.63
10 0.55
11 0.47
12 0.41
13 0.36
14 0.32
15 0.27
16 0.28
17 0.22
18 0.25
19 0.25
20 0.27
21 0.35
22 0.36
23 0.36
24 0.37
25 0.42
26 0.47
27 0.48
28 0.49
29 0.44
30 0.43
31 0.45
32 0.45
33 0.47
34 0.46
35 0.48
36 0.44
37 0.42
38 0.38
39 0.35
40 0.34
41 0.3
42 0.28
43 0.25
44 0.27
45 0.26
46 0.27
47 0.27
48 0.25
49 0.21
50 0.15
51 0.13
52 0.11
53 0.1
54 0.09
55 0.08
56 0.06
57 0.08
58 0.08
59 0.08
60 0.07
61 0.07
62 0.07
63 0.06
64 0.07
65 0.06
66 0.05
67 0.06
68 0.13
69 0.13
70 0.14
71 0.21
72 0.21
73 0.21
74 0.21
75 0.21
76 0.18
77 0.2
78 0.2
79 0.15
80 0.14
81 0.14
82 0.14
83 0.14
84 0.11
85 0.1
86 0.08
87 0.08
88 0.08
89 0.08
90 0.08
91 0.09
92 0.08
93 0.08