FuNGI

A0A1E3QF80

Protein Details

Accession

A0A1E3QF80

Localization Confidence

Medium

Confidence Score

11.8

NoLS Segment(s)

Position	Sequence	Protein Nature
356-387	QTNTSQPPPGNKRKPGEKRRHKQRRNVFASDI	Hydrophilic

NLS Segment(s)

Position	Sequence
365-380	GNKRKPGEKRRHKQRR

Subcellular Location(s)

nucl 12.5, cyto_nucl 7.5, mito 7, extr 6

Family & Domain DBs

InterPro	View protein in InterPro IPR019258 Mediator_Med4
Gene Ontology	GO:0016592 C:mediator complex GO:0003712 F:transcription coregulator activity GO:0006357 P:regulation of transcription by RNA polymerase II
Pfam	View protein in Pfam PF10018 Med4

Amino Acid Sequences

MAASPRAPQSAISMQPLVSAHLPLSPATVLPKSSSTTVPPRSLADAIAERKQLFQTRMAIPGVQPTFQKLKTPLQSIPTSTDFTRSNTPSSATTPITSTTPTTVSGYNALSTPASSDVPKLTIFGALDAFERKIADLIETVGLYSPGAGTAKDLVDLDLQLDKAVDELLLYQENKALIAKLSAESSDLDSQLNILLKALSDARAALLSIPGADDLGSNDTPDTPKTSYTELLAYATRISKFASAPPGFAPPASWASQPPPELAKTETSADGQAPTVAETVSATLKEAYKDPSSIPANLPWPTEDEMRRGMLVQYNRMFGSDGGENGVVATEIAVVVPGQEGHPDNKPHEMSSSQVQTNTSQPPPGNKRKPGEKRRHKQRRNVFASDIDDDDDSSDDGDGEADDDDDGFDDGGNNDDGILSSSSDYADTQDALPHPNPNSGLGNNGTTAPASNGGHVRQDGAVNREALLDLDLFEPDED

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.29
2	0.31
3	0.31
4	0.27
5	0.21
6	0.19
7	0.15
8	0.16
9	0.17
10	0.14
11	0.16
12	0.13
13	0.13
14	0.16
15	0.18
16	0.17
17	0.18
18	0.2
19	0.21
20	0.23
21	0.25
22	0.27
23	0.35
24	0.4
25	0.42
26	0.41
27	0.41
28	0.42
29	0.41
30	0.35
31	0.31
32	0.31
33	0.31
34	0.34
35	0.35
36	0.32
37	0.33
38	0.37
39	0.38
40	0.33
41	0.34
42	0.36
43	0.35
44	0.39
45	0.38
46	0.35
47	0.29
48	0.35
49	0.31
50	0.27
51	0.24
52	0.25
53	0.3
54	0.3
55	0.36
56	0.32
57	0.4
58	0.45
59	0.49
60	0.48
61	0.48
62	0.5
63	0.47
64	0.47
65	0.41
66	0.37
67	0.33
68	0.34
69	0.29
70	0.29
71	0.35
72	0.32
73	0.32
74	0.3
75	0.32
76	0.29
77	0.31
78	0.32
79	0.26
80	0.24
81	0.22
82	0.23
83	0.22
84	0.21
85	0.19
86	0.16
87	0.15
88	0.16
89	0.17
90	0.16
91	0.16
92	0.18
93	0.17
94	0.16
95	0.15
96	0.14
97	0.12
98	0.11
99	0.11
100	0.1
101	0.11
102	0.1
103	0.12
104	0.12
105	0.14
106	0.14
107	0.13
108	0.11
109	0.13
110	0.12
111	0.12
112	0.11
113	0.1
114	0.11
115	0.12
116	0.11
117	0.1
118	0.1
119	0.09
120	0.1
121	0.09
122	0.09
123	0.08
124	0.09
125	0.09
126	0.09
127	0.09
128	0.08
129	0.08
130	0.06
131	0.06
132	0.05
133	0.05
134	0.05
135	0.05
136	0.05
137	0.08
138	0.08
139	0.09
140	0.09
141	0.09
142	0.09
143	0.09
144	0.09
145	0.09
146	0.08
147	0.08
148	0.08
149	0.06
150	0.06
151	0.06
152	0.05
153	0.03
154	0.04
155	0.05
156	0.08
157	0.08
158	0.08
159	0.1
160	0.1
161	0.1
162	0.1
163	0.09
164	0.07
165	0.07
166	0.08
167	0.07
168	0.08
169	0.08
170	0.08
171	0.08
172	0.11
173	0.12
174	0.11
175	0.1
176	0.1
177	0.1
178	0.11
179	0.11
180	0.08
181	0.07
182	0.06
183	0.06
184	0.07
185	0.08
186	0.07
187	0.06
188	0.06
189	0.06
190	0.06
191	0.06
192	0.06
193	0.05
194	0.04
195	0.04
196	0.04
197	0.04
198	0.04
199	0.04
200	0.03
201	0.04
202	0.07
203	0.07
204	0.07
205	0.07
206	0.08
207	0.09
208	0.09
209	0.12
210	0.09
211	0.11
212	0.12
213	0.14
214	0.14
215	0.15
216	0.15
217	0.12
218	0.13
219	0.12
220	0.1
221	0.09
222	0.1
223	0.1
224	0.09
225	0.09
226	0.1
227	0.1
228	0.12
229	0.19
230	0.18
231	0.19
232	0.19
233	0.21
234	0.2
235	0.19
236	0.17
237	0.11
238	0.14
239	0.14
240	0.13
241	0.12
242	0.15
243	0.18
244	0.18
245	0.17
246	0.16
247	0.15
248	0.16
249	0.17
250	0.16
251	0.14
252	0.15
253	0.15
254	0.14
255	0.14
256	0.12
257	0.12
258	0.1
259	0.09
260	0.07
261	0.07
262	0.07
263	0.06
264	0.05
265	0.05
266	0.06
267	0.06
268	0.06
269	0.06
270	0.07
271	0.08
272	0.09
273	0.1
274	0.13
275	0.14
276	0.15
277	0.15
278	0.2
279	0.22
280	0.23
281	0.22
282	0.22
283	0.24
284	0.24
285	0.24
286	0.18
287	0.19
288	0.19
289	0.22
290	0.2
291	0.2
292	0.21
293	0.21
294	0.2
295	0.18
296	0.17
297	0.18
298	0.18
299	0.22
300	0.22
301	0.23
302	0.23
303	0.23
304	0.22
305	0.17
306	0.18
307	0.13
308	0.11
309	0.11
310	0.11
311	0.1
312	0.09
313	0.09
314	0.06
315	0.04
316	0.04
317	0.03
318	0.03
319	0.03
320	0.03
321	0.03
322	0.03
323	0.03
324	0.04
325	0.04
326	0.06
327	0.08
328	0.1
329	0.16
330	0.19
331	0.2
332	0.26
333	0.27
334	0.25
335	0.27
336	0.25
337	0.22
338	0.26
339	0.3
340	0.25
341	0.26
342	0.27
343	0.26
344	0.3
345	0.33
346	0.28
347	0.26
348	0.26
349	0.34
350	0.42
351	0.52
352	0.56
353	0.58
354	0.64
355	0.71
356	0.81
357	0.83
358	0.85
359	0.85
360	0.87
361	0.91
362	0.95
363	0.93
364	0.92
365	0.92
366	0.92
367	0.89
368	0.84
369	0.76
370	0.7
371	0.65
372	0.57
373	0.47
374	0.37
375	0.28
376	0.23
377	0.2
378	0.15
379	0.11
380	0.09
381	0.08
382	0.06
383	0.06
384	0.06
385	0.05
386	0.05
387	0.05
388	0.05
389	0.05
390	0.05
391	0.05
392	0.05
393	0.06
394	0.05
395	0.05
396	0.06
397	0.06
398	0.08
399	0.08
400	0.07
401	0.07
402	0.07
403	0.07
404	0.09
405	0.09
406	0.08
407	0.09
408	0.09
409	0.1
410	0.1
411	0.1
412	0.1
413	0.11
414	0.11
415	0.11
416	0.15
417	0.16
418	0.2
419	0.22
420	0.25
421	0.26
422	0.29
423	0.29
424	0.29
425	0.32
426	0.27
427	0.3
428	0.27
429	0.26
430	0.23
431	0.23
432	0.2
433	0.16
434	0.16
435	0.13
436	0.16
437	0.15
438	0.18
439	0.21
440	0.22
441	0.26
442	0.26
443	0.26
444	0.23
445	0.27
446	0.28
447	0.29
448	0.31
449	0.27
450	0.27
451	0.26
452	0.24
453	0.2
454	0.17
455	0.13
456	0.1
457	0.1
458	0.1

A0A1E3QF80

3D AlphaFold-predicted Structure Viewer