Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3PYV4

Protein Details
Accession A0A1E3PYV4   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
136-167AQTLRYKSFEKPNSRRKRLRIERTQKLFNKSYHydrophilic
NLS Segment(s)
PositionSequence
150-153RRKR
Subcellular Location(s) mito 21, nucl 5
Family & Domain DBs
Amino Acid Sequences MSMAETLARGLRSGNLSRFVRPQVANSRCLFSSGVSWLAAESHNSVPNVKVDAIQLLRDSVQADEVRSEPVGEPTEKPAQGEAAPAQATVHRYITLGSMPRVGPYAGRSFEVASPELLPVQLLKLRRLVTANEVHAQTLRYKSFEKPNSRRKRLRIERTQKLFNKSYGQMVNKMKKYWKMGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.32
3 0.34
4 0.37
5 0.41
6 0.41
7 0.42
8 0.38
9 0.42
10 0.44
11 0.46
12 0.49
13 0.46
14 0.46
15 0.39
16 0.4
17 0.33
18 0.23
19 0.22
20 0.19
21 0.18
22 0.15
23 0.14
24 0.12
25 0.13
26 0.12
27 0.11
28 0.12
29 0.13
30 0.16
31 0.17
32 0.17
33 0.17
34 0.18
35 0.2
36 0.17
37 0.15
38 0.12
39 0.16
40 0.16
41 0.16
42 0.15
43 0.13
44 0.13
45 0.12
46 0.12
47 0.08
48 0.11
49 0.11
50 0.11
51 0.12
52 0.12
53 0.12
54 0.12
55 0.12
56 0.09
57 0.11
58 0.13
59 0.13
60 0.13
61 0.16
62 0.21
63 0.2
64 0.2
65 0.18
66 0.17
67 0.16
68 0.16
69 0.12
70 0.1
71 0.09
72 0.09
73 0.09
74 0.09
75 0.1
76 0.1
77 0.1
78 0.08
79 0.08
80 0.09
81 0.09
82 0.1
83 0.1
84 0.09
85 0.11
86 0.11
87 0.11
88 0.12
89 0.11
90 0.1
91 0.11
92 0.14
93 0.13
94 0.14
95 0.14
96 0.14
97 0.16
98 0.17
99 0.15
100 0.12
101 0.12
102 0.11
103 0.11
104 0.09
105 0.08
106 0.06
107 0.07
108 0.09
109 0.1
110 0.11
111 0.15
112 0.17
113 0.18
114 0.2
115 0.2
116 0.23
117 0.27
118 0.29
119 0.28
120 0.27
121 0.26
122 0.25
123 0.25
124 0.22
125 0.22
126 0.21
127 0.2
128 0.22
129 0.27
130 0.36
131 0.44
132 0.51
133 0.56
134 0.66
135 0.75
136 0.82
137 0.86
138 0.84
139 0.87
140 0.87
141 0.88
142 0.88
143 0.88
144 0.88
145 0.87
146 0.89
147 0.84
148 0.81
149 0.74
150 0.67
151 0.63
152 0.55
153 0.55
154 0.52
155 0.49
156 0.5
157 0.55
158 0.61
159 0.59
160 0.62
161 0.61
162 0.61