Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QFF1

Protein Details
Accession A0A1E3QFF1   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
235-262LKMSKNVRMELRRKRLRKKLLKLLRLGFHydrophilic
NLS Segment(s)
PositionSequence
245-256LRRKRLRKKLLK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, cyto 2.5, cysk 2
Family & Domain DBs
Amino Acid Sequences MYSFMRYSSIGEVSHFRVSEICEYNDADMLNCHKDMPNPSLKVTSEHGDATSTECIADGTAQISSLDLDNVDDAVGEDSSHAYINRGSIHVRFVEPKIDLHEFLSDKGLIDPDDEGSWQFLYRNQHSPFGICSYCLEMEDREIYSRQRRQIASQLVKIIHWDSLESIESVTRRAERKADEFVQQLKVQSKTIDQERCIREYQLYRVDSLDEYTIAKMIPGLDAELVRQEWDEYLLKMSKNVRMELRRKRLRKKLLKLLRLGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.23
4 0.22
5 0.24
6 0.3
7 0.3
8 0.28
9 0.26
10 0.27
11 0.28
12 0.28
13 0.25
14 0.18
15 0.16
16 0.18
17 0.19
18 0.18
19 0.18
20 0.17
21 0.22
22 0.27
23 0.31
24 0.36
25 0.35
26 0.37
27 0.4
28 0.39
29 0.38
30 0.37
31 0.33
32 0.26
33 0.25
34 0.23
35 0.2
36 0.19
37 0.19
38 0.17
39 0.13
40 0.11
41 0.1
42 0.1
43 0.09
44 0.09
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.04
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.06
67 0.07
68 0.06
69 0.06
70 0.07
71 0.09
72 0.1
73 0.1
74 0.11
75 0.12
76 0.14
77 0.14
78 0.15
79 0.16
80 0.16
81 0.18
82 0.18
83 0.18
84 0.2
85 0.2
86 0.19
87 0.17
88 0.2
89 0.17
90 0.17
91 0.18
92 0.14
93 0.12
94 0.12
95 0.12
96 0.08
97 0.08
98 0.08
99 0.07
100 0.07
101 0.07
102 0.06
103 0.07
104 0.07
105 0.06
106 0.06
107 0.09
108 0.14
109 0.17
110 0.25
111 0.26
112 0.29
113 0.29
114 0.29
115 0.27
116 0.25
117 0.22
118 0.14
119 0.13
120 0.12
121 0.12
122 0.12
123 0.11
124 0.08
125 0.09
126 0.1
127 0.1
128 0.09
129 0.1
130 0.13
131 0.2
132 0.24
133 0.27
134 0.32
135 0.33
136 0.35
137 0.42
138 0.49
139 0.46
140 0.44
141 0.43
142 0.37
143 0.36
144 0.34
145 0.27
146 0.18
147 0.14
148 0.11
149 0.08
150 0.1
151 0.1
152 0.09
153 0.08
154 0.09
155 0.09
156 0.1
157 0.11
158 0.13
159 0.14
160 0.16
161 0.2
162 0.23
163 0.26
164 0.32
165 0.33
166 0.33
167 0.34
168 0.35
169 0.35
170 0.33
171 0.32
172 0.3
173 0.29
174 0.26
175 0.24
176 0.24
177 0.25
178 0.32
179 0.34
180 0.32
181 0.39
182 0.41
183 0.44
184 0.43
185 0.38
186 0.36
187 0.35
188 0.39
189 0.38
190 0.36
191 0.33
192 0.32
193 0.32
194 0.27
195 0.25
196 0.2
197 0.12
198 0.12
199 0.12
200 0.12
201 0.1
202 0.09
203 0.08
204 0.08
205 0.08
206 0.07
207 0.08
208 0.08
209 0.09
210 0.09
211 0.11
212 0.11
213 0.11
214 0.11
215 0.1
216 0.09
217 0.13
218 0.14
219 0.13
220 0.17
221 0.2
222 0.2
223 0.24
224 0.28
225 0.3
226 0.32
227 0.36
228 0.4
229 0.46
230 0.56
231 0.62
232 0.7
233 0.74
234 0.8
235 0.86
236 0.88
237 0.9
238 0.91
239 0.91
240 0.91
241 0.91
242 0.9