Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3QBB3

Protein Details
Accession A0A1E3QBB3    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
59-84LERFPDYRYQPRRNTKRNGNDFQSNSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences MSAAFILYRQHHHAVVVAEHPGKTNPEISKIIGEQWRQLSGDEKAVWQKLGDEEKKSHLERFPDYRYQPRRNTKRNGNDFQSNSHSNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.22
4 0.21
5 0.2
6 0.19
7 0.2
8 0.17
9 0.17
10 0.17
11 0.21
12 0.18
13 0.22
14 0.23
15 0.23
16 0.25
17 0.23
18 0.26
19 0.25
20 0.25
21 0.23
22 0.23
23 0.23
24 0.21
25 0.21
26 0.19
27 0.16
28 0.18
29 0.15
30 0.15
31 0.16
32 0.16
33 0.16
34 0.13
35 0.13
36 0.13
37 0.2
38 0.22
39 0.22
40 0.24
41 0.28
42 0.34
43 0.34
44 0.34
45 0.3
46 0.32
47 0.34
48 0.39
49 0.4
50 0.42
51 0.45
52 0.52
53 0.58
54 0.62
55 0.67
56 0.71
57 0.77
58 0.78
59 0.84
60 0.85
61 0.86
62 0.88
63 0.87
64 0.82
65 0.81
66 0.74
67 0.7
68 0.67