Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C7Z0J8

Protein Details
Accession C7Z0J8    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-21SSGRNKKGRGHVKPIRCSNCSHydrophilic
75-105GKIVRVRSRVGRRNRAPPPRVRYNKDGKKIVBasic
NLS Segment(s)
PositionSequence
79-103RVRSRVGRRNRAPPPRVRYNKDGKK
Subcellular Location(s) mito 12, nucl 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG nhe:NECHADRAFT_40390  -  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences SSGRNKKGRGHVKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFAEYTVPKMYLKLQYCVSCAIHGKIVRVRSRVGRRNRAPPPRVRYNKDGKKIVPTTPKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.82
3 0.74
4 0.73
5 0.71
6 0.71
7 0.7
8 0.68
9 0.65
10 0.66
11 0.69
12 0.7
13 0.73
14 0.72
15 0.73
16 0.74
17 0.76
18 0.72
19 0.73
20 0.69
21 0.69
22 0.61
23 0.53
24 0.46
25 0.38
26 0.35
27 0.28
28 0.25
29 0.16
30 0.15
31 0.12
32 0.1
33 0.1
34 0.08
35 0.08
36 0.06
37 0.05
38 0.05
39 0.05
40 0.05
41 0.06
42 0.06
43 0.07
44 0.07
45 0.07
46 0.07
47 0.08
48 0.1
49 0.16
50 0.18
51 0.2
52 0.23
53 0.24
54 0.25
55 0.27
56 0.24
57 0.2
58 0.2
59 0.18
60 0.19
61 0.19
62 0.21
63 0.22
64 0.28
65 0.31
66 0.31
67 0.33
68 0.38
69 0.47
70 0.53
71 0.59
72 0.63
73 0.65
74 0.74
75 0.81
76 0.82
77 0.79
78 0.8
79 0.79
80 0.79
81 0.82
82 0.79
83 0.77
84 0.78
85 0.81
86 0.8
87 0.79
88 0.71
89 0.72
90 0.69
91 0.69