Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3Q015

Protein Details
Accession A0A1E3Q015    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
31-54AENETKQHARKKVKKRCKAISYEAHydrophilic
NLS Segment(s)
PositionSequence
40-45RKKVKK
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MRKTRTKGKRVVLKGHFHISTQDLHDAVVTAENETKQHARKKVKKRCKAISYEAKSEDDTEEEGKEDIESDIEDCIIVDC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.71
3 0.61
4 0.51
5 0.46
6 0.38
7 0.33
8 0.27
9 0.24
10 0.17
11 0.16
12 0.16
13 0.13
14 0.12
15 0.11
16 0.09
17 0.08
18 0.09
19 0.09
20 0.09
21 0.11
22 0.14
23 0.16
24 0.23
25 0.3
26 0.39
27 0.48
28 0.59
29 0.68
30 0.76
31 0.81
32 0.84
33 0.86
34 0.84
35 0.81
36 0.8
37 0.79
38 0.75
39 0.71
40 0.64
41 0.56
42 0.49
43 0.43
44 0.34
45 0.25
46 0.21
47 0.16
48 0.14
49 0.13
50 0.13
51 0.11
52 0.1
53 0.1
54 0.08
55 0.08
56 0.08
57 0.07
58 0.08
59 0.07
60 0.07