Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3PYP7

Protein Details
Accession A0A1E3PYP7    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
17-57QLESCRPQERHRCRLWCRRRHRRNRTRLRPRLPPPRPHSRFBasic
NLS Segment(s)
PositionSequence
34-53RRRHRRNRTRLRPRLPPPRP
Subcellular Location(s) cyto_nucl 10.833, nucl 10, cyto 9.5, mito 6, cyto_pero 5.666
Family & Domain DBs
Amino Acid Sequences MRVTPAGLSEIPGNSPQLESCRPQERHRCRLWCRRRHRRNRTRLRPRLPPPRPHSRFVFELACLFWGGTLGYGTVKTISDSSVRNCKGDIAEFRPTIMVGVPAVWETVRKGILSKVHAQGSAVSKVFWAAYHAKSFMQSWRIPGSGVLDAAIFKKVKEATGGRLRVVFNGGAEGILSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.15
4 0.18
5 0.21
6 0.23
7 0.29
8 0.38
9 0.41
10 0.49
11 0.59
12 0.63
13 0.69
14 0.74
15 0.77
16 0.76
17 0.84
18 0.86
19 0.85
20 0.87
21 0.89
22 0.91
23 0.92
24 0.95
25 0.94
26 0.95
27 0.96
28 0.96
29 0.96
30 0.95
31 0.92
32 0.91
33 0.89
34 0.89
35 0.86
36 0.85
37 0.8
38 0.81
39 0.78
40 0.72
41 0.68
42 0.61
43 0.55
44 0.49
45 0.44
46 0.33
47 0.29
48 0.25
49 0.2
50 0.15
51 0.13
52 0.08
53 0.06
54 0.06
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.05
61 0.05
62 0.05
63 0.05
64 0.06
65 0.06
66 0.09
67 0.1
68 0.13
69 0.21
70 0.21
71 0.21
72 0.21
73 0.21
74 0.2
75 0.21
76 0.22
77 0.18
78 0.23
79 0.22
80 0.22
81 0.21
82 0.2
83 0.17
84 0.14
85 0.09
86 0.04
87 0.04
88 0.04
89 0.04
90 0.05
91 0.04
92 0.05
93 0.05
94 0.07
95 0.08
96 0.07
97 0.08
98 0.11
99 0.16
100 0.19
101 0.24
102 0.26
103 0.27
104 0.27
105 0.26
106 0.27
107 0.27
108 0.27
109 0.22
110 0.17
111 0.16
112 0.16
113 0.16
114 0.12
115 0.12
116 0.13
117 0.15
118 0.18
119 0.19
120 0.19
121 0.2
122 0.21
123 0.22
124 0.24
125 0.22
126 0.24
127 0.27
128 0.27
129 0.25
130 0.25
131 0.24
132 0.19
133 0.18
134 0.15
135 0.11
136 0.12
137 0.12
138 0.15
139 0.12
140 0.1
141 0.16
142 0.16
143 0.17
144 0.23
145 0.25
146 0.3
147 0.4
148 0.42
149 0.38
150 0.42
151 0.41
152 0.36
153 0.36
154 0.28
155 0.19
156 0.18
157 0.17
158 0.13