Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3Q5U4

Protein Details
Accession A0A1E3Q5U4    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
58-78PTKRTRQMIRTHDPRRRRAGLBasic
NLS Segment(s)
PositionSequence
72-75RRRR
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MEGEAESLVSMMTSLKDNSGLYTHEQTPQMRRRTTTTSSSSPAPPPLPPNIRYYIRLPTKRTRQMIRTHDPRRRRAGLPLSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.1
4 0.1
5 0.12
6 0.13
7 0.13
8 0.15
9 0.19
10 0.2
11 0.22
12 0.25
13 0.26
14 0.33
15 0.4
16 0.43
17 0.4
18 0.41
19 0.42
20 0.45
21 0.47
22 0.45
23 0.42
24 0.39
25 0.39
26 0.39
27 0.36
28 0.31
29 0.29
30 0.24
31 0.2
32 0.19
33 0.24
34 0.26
35 0.26
36 0.29
37 0.32
38 0.34
39 0.35
40 0.35
41 0.38
42 0.43
43 0.47
44 0.49
45 0.53
46 0.6
47 0.67
48 0.71
49 0.69
50 0.66
51 0.71
52 0.74
53 0.74
54 0.75
55 0.76
56 0.78
57 0.79
58 0.81
59 0.8
60 0.77
61 0.7
62 0.69