Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3Q6V9

Protein Details
Accession A0A1E3Q6V9   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
25-44LLQIRKKRSKGKGIKLQGEFHydrophilic
58-82AEETPKEKRRRGRPRKRPIQEVDNVBasic
NLS Segment(s)
PositionSequence
29-37RKKRSKGKG
62-75PKEKRRRGRPRKRP
Subcellular Location(s) nucl 18.5, cyto_nucl 14.333, mito_nucl 11.332, cyto 6
Family & Domain DBs
Amino Acid Sequences MTQLVESQNAELKILRKELQGCKELLQIRKKRSKGKGIKLQGEFVFSTEEVLKIVREAEETPKEKRRRGRPRKRPIQEVDNVQEEEEVENSSSESELDLINCVARRTRSKLEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.26
4 0.33
5 0.4
6 0.44
7 0.44
8 0.41
9 0.39
10 0.44
11 0.45
12 0.45
13 0.47
14 0.48
15 0.54
16 0.62
17 0.66
18 0.69
19 0.72
20 0.76
21 0.76
22 0.79
23 0.8
24 0.79
25 0.81
26 0.74
27 0.7
28 0.59
29 0.51
30 0.41
31 0.31
32 0.24
33 0.16
34 0.15
35 0.11
36 0.1
37 0.08
38 0.08
39 0.07
40 0.06
41 0.06
42 0.05
43 0.06
44 0.07
45 0.11
46 0.17
47 0.2
48 0.24
49 0.33
50 0.37
51 0.41
52 0.48
53 0.55
54 0.6
55 0.69
56 0.77
57 0.79
58 0.86
59 0.92
60 0.91
61 0.89
62 0.85
63 0.82
64 0.76
65 0.72
66 0.65
67 0.58
68 0.51
69 0.42
70 0.35
71 0.27
72 0.22
73 0.15
74 0.12
75 0.08
76 0.08
77 0.08
78 0.08
79 0.08
80 0.07
81 0.07
82 0.06
83 0.06
84 0.07
85 0.08
86 0.08
87 0.1
88 0.12
89 0.12
90 0.16
91 0.21
92 0.27
93 0.33