Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3Q5I9

Protein Details
Accession A0A1E3Q5I9    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-38GPPNTRRPPGRPHKKRVRTEDVGBasic
NLS Segment(s)
PositionSequence
21-34RRPPGRPHKKRVRT
Subcellular Location(s) cyto_nucl 17.333, nucl 16.5, cyto 10, mito_nucl 9.664
Family & Domain DBs
Amino Acid Sequences MSAVIVTEDDDLPHVGPPNTRRPPGRPHKKRVRTEDVGIAKKRVKVTCGRCHKQLGHNASTCTEPQQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.16
4 0.2
5 0.3
6 0.35
7 0.39
8 0.4
9 0.43
10 0.52
11 0.59
12 0.66
13 0.65
14 0.7
15 0.77
16 0.84
17 0.88
18 0.86
19 0.84
20 0.77
21 0.7
22 0.68
23 0.63
24 0.6
25 0.52
26 0.46
27 0.4
28 0.39
29 0.42
30 0.35
31 0.31
32 0.34
33 0.42
34 0.49
35 0.57
36 0.58
37 0.58
38 0.64
39 0.66
40 0.65
41 0.65
42 0.63
43 0.6
44 0.59
45 0.56
46 0.5
47 0.47
48 0.4