Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4SGM6

Protein Details
Accession A0A1E4SGM6    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
160-183ITSHGEKLKKDKKKGIFGKIKEVFBasic
NLS Segment(s)
PositionSequence
167-175LKKDKKKGI
Subcellular Location(s) nucl 15, cyto_nucl 12.5, mito 6, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR022024  DUF3602  
Pfam View protein in Pfam  
PF12223  DUF3602  
Amino Acid Sequences MPYSTGRGGAGNIQSSPSISSHQHESTDSQPRNPISPSSSQEGSGHKKIYYSTGRGGAGNIQKSDSAPSPKLVPQGSNTPKLHTDKVSTGRGGYGNMVSNDDPELTRKLQDVDGPSKDDLHAVASNKSFSVGRGGFGNVISKTRSGASSQGLSENHLYTITSHGEKLKKDKKKGIFGKIKEVFNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.2
4 0.16
5 0.16
6 0.16
7 0.19
8 0.24
9 0.26
10 0.26
11 0.26
12 0.28
13 0.32
14 0.4
15 0.39
16 0.35
17 0.39
18 0.38
19 0.4
20 0.38
21 0.34
22 0.28
23 0.33
24 0.34
25 0.34
26 0.33
27 0.32
28 0.32
29 0.36
30 0.38
31 0.36
32 0.35
33 0.29
34 0.3
35 0.29
36 0.34
37 0.33
38 0.29
39 0.28
40 0.3
41 0.31
42 0.3
43 0.3
44 0.28
45 0.28
46 0.27
47 0.24
48 0.2
49 0.2
50 0.2
51 0.22
52 0.2
53 0.2
54 0.18
55 0.19
56 0.21
57 0.22
58 0.26
59 0.24
60 0.22
61 0.2
62 0.28
63 0.31
64 0.37
65 0.35
66 0.33
67 0.37
68 0.39
69 0.38
70 0.3
71 0.29
72 0.26
73 0.31
74 0.31
75 0.27
76 0.24
77 0.23
78 0.21
79 0.19
80 0.14
81 0.1
82 0.1
83 0.1
84 0.12
85 0.1
86 0.1
87 0.1
88 0.1
89 0.09
90 0.09
91 0.11
92 0.1
93 0.11
94 0.12
95 0.13
96 0.13
97 0.16
98 0.19
99 0.22
100 0.23
101 0.25
102 0.24
103 0.23
104 0.22
105 0.2
106 0.15
107 0.13
108 0.14
109 0.13
110 0.16
111 0.16
112 0.16
113 0.16
114 0.17
115 0.14
116 0.11
117 0.17
118 0.15
119 0.14
120 0.15
121 0.16
122 0.16
123 0.16
124 0.19
125 0.13
126 0.14
127 0.14
128 0.13
129 0.14
130 0.14
131 0.15
132 0.13
133 0.16
134 0.18
135 0.2
136 0.2
137 0.24
138 0.23
139 0.24
140 0.25
141 0.22
142 0.19
143 0.17
144 0.16
145 0.12
146 0.16
147 0.17
148 0.16
149 0.17
150 0.22
151 0.27
152 0.3
153 0.4
154 0.47
155 0.53
156 0.6
157 0.68
158 0.72
159 0.78
160 0.83
161 0.84
162 0.84
163 0.79
164 0.81
165 0.78