Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4SFV8

Protein Details
Accession A0A1E4SFV8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
59-83CFWCHGKGFRKKWQHITARKSDQQNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MVRQITCWWSLMSAHPGVYGTRMKEILVRWMRRRERQGGGDKGGYCRGTSGFELTVFLCFWCHGKGFRKKWQHITARKSDQQNQASTIFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.19
4 0.17
5 0.2
6 0.19
7 0.16
8 0.17
9 0.17
10 0.17
11 0.2
12 0.2
13 0.27
14 0.32
15 0.37
16 0.4
17 0.5
18 0.56
19 0.6
20 0.66
21 0.62
22 0.6
23 0.62
24 0.64
25 0.59
26 0.56
27 0.52
28 0.46
29 0.41
30 0.37
31 0.3
32 0.21
33 0.16
34 0.14
35 0.12
36 0.12
37 0.13
38 0.1
39 0.1
40 0.11
41 0.11
42 0.11
43 0.09
44 0.08
45 0.07
46 0.07
47 0.08
48 0.08
49 0.1
50 0.14
51 0.24
52 0.34
53 0.41
54 0.51
55 0.6
56 0.66
57 0.74
58 0.79
59 0.8
60 0.79
61 0.81
62 0.81
63 0.8
64 0.8
65 0.78
66 0.77
67 0.76
68 0.73
69 0.68
70 0.61