Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4SK98

Protein Details
Accession A0A1E4SK98    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-38QTPKVDKQEKPKQPKGRAYKRLLHydrophilic
NLS Segment(s)
PositionSequence
18-34PKVDKQEKPKQPKGRAY
Subcellular Location(s) nucl 16, mito 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences GKVHGSLARAGKVKSQTPKVDKQEKPKQPKGRAYKRLLYTRRFINVTLTNGKRKMNPSPASQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.5
4 0.54
5 0.63
6 0.66
7 0.71
8 0.7
9 0.72
10 0.75
11 0.76
12 0.79
13 0.79
14 0.79
15 0.77
16 0.82
17 0.82
18 0.82
19 0.82
20 0.78
21 0.76
22 0.73
23 0.75
24 0.72
25 0.65
26 0.59
27 0.55
28 0.54
29 0.48
30 0.41
31 0.39
32 0.38
33 0.39
34 0.43
35 0.42
36 0.44
37 0.46
38 0.48
39 0.46
40 0.46
41 0.5
42 0.52