Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4SKV0

Protein Details
Accession A0A1E4SKV0    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MIGPHIPKELREQRKKQKEAEKTQPEPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 13.833, cyto 5.5, cyto_pero 3.832
Family & Domain DBs
Amino Acid Sequences MIGPHIPKELREQRKKQKEAEKTQPEPSEDISSDDDIDGPQLGPPVPQVPSLQEEKHQDGKKSDSEVAKKPTLLELHQKKLKESGISDKNRIHKFDHKQGLNDEVKKEILRNVNAKGLSRFTTGSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.85
4 0.84
5 0.84
6 0.83
7 0.84
8 0.83
9 0.77
10 0.79
11 0.74
12 0.66
13 0.57
14 0.5
15 0.44
16 0.34
17 0.32
18 0.27
19 0.23
20 0.21
21 0.19
22 0.16
23 0.11
24 0.11
25 0.08
26 0.06
27 0.06
28 0.06
29 0.06
30 0.06
31 0.07
32 0.09
33 0.09
34 0.1
35 0.1
36 0.11
37 0.14
38 0.17
39 0.17
40 0.19
41 0.22
42 0.25
43 0.33
44 0.34
45 0.33
46 0.32
47 0.35
48 0.33
49 0.32
50 0.32
51 0.28
52 0.3
53 0.33
54 0.36
55 0.33
56 0.31
57 0.29
58 0.28
59 0.25
60 0.23
61 0.28
62 0.29
63 0.36
64 0.39
65 0.39
66 0.37
67 0.4
68 0.4
69 0.33
70 0.29
71 0.31
72 0.37
73 0.41
74 0.45
75 0.45
76 0.51
77 0.52
78 0.52
79 0.48
80 0.48
81 0.52
82 0.58
83 0.63
84 0.57
85 0.56
86 0.56
87 0.6
88 0.57
89 0.53
90 0.44
91 0.37
92 0.36
93 0.33
94 0.32
95 0.3
96 0.3
97 0.33
98 0.36
99 0.37
100 0.41
101 0.42
102 0.43
103 0.41
104 0.37
105 0.34
106 0.32