Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4SS20

Protein Details
Accession A0A1E4SS20    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
166-192VDRGLNDSKRKFNKNNKFKIFKGKRRHBasic
NLS Segment(s)
PositionSequence
174-192KRKFNKNNKFKIFKGKRRH
Subcellular Location(s) cyto_nucl 14.333, cyto 14, nucl 12.5, mito_nucl 7.166, cyto_pero 7.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR003034  SAP_dom  
IPR036361  SAP_dom_sf  
IPR040746  THO1_MOS11_C  
Pfam View protein in Pfam  
PF02037  SAP  
PF18592  Tho1_MOS11_C  
PROSITE View protein in PROSITE  
PS50800  SAP  
Amino Acid Sequences MADYASQTVAQLKEVLKSKGLSTDGKKADLVARLTEADANGDELLAVEGETVAEPVAAEAAAPEQTSEAQPAEAVAPAAVADSESTLTVIQPAEEAAKEEPKEEPPKVLTPEERKQLAVDLLQKKVLRAEKFGDEAAAEAAKKDLTRVEKFGVELGTALAREIGLVDRGLNDSKRKFNKNNKFKIFKGKRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.27
4 0.27
5 0.27
6 0.3
7 0.33
8 0.33
9 0.33
10 0.41
11 0.4
12 0.41
13 0.4
14 0.35
15 0.36
16 0.35
17 0.32
18 0.24
19 0.23
20 0.22
21 0.23
22 0.22
23 0.18
24 0.14
25 0.12
26 0.12
27 0.09
28 0.09
29 0.08
30 0.07
31 0.07
32 0.05
33 0.05
34 0.03
35 0.03
36 0.04
37 0.04
38 0.04
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.05
53 0.06
54 0.07
55 0.07
56 0.06
57 0.06
58 0.07
59 0.07
60 0.06
61 0.06
62 0.04
63 0.04
64 0.04
65 0.04
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.04
73 0.04
74 0.04
75 0.05
76 0.05
77 0.04
78 0.04
79 0.04
80 0.05
81 0.05
82 0.06
83 0.06
84 0.09
85 0.09
86 0.1
87 0.11
88 0.15
89 0.2
90 0.19
91 0.2
92 0.2
93 0.23
94 0.26
95 0.27
96 0.28
97 0.31
98 0.36
99 0.4
100 0.38
101 0.35
102 0.32
103 0.31
104 0.27
105 0.22
106 0.25
107 0.23
108 0.23
109 0.27
110 0.27
111 0.25
112 0.29
113 0.33
114 0.26
115 0.26
116 0.28
117 0.28
118 0.29
119 0.29
120 0.24
121 0.17
122 0.16
123 0.14
124 0.11
125 0.08
126 0.06
127 0.07
128 0.07
129 0.07
130 0.08
131 0.12
132 0.18
133 0.21
134 0.24
135 0.26
136 0.27
137 0.28
138 0.29
139 0.25
140 0.18
141 0.15
142 0.13
143 0.11
144 0.09
145 0.09
146 0.07
147 0.06
148 0.06
149 0.06
150 0.06
151 0.07
152 0.07
153 0.07
154 0.08
155 0.11
156 0.15
157 0.17
158 0.24
159 0.28
160 0.37
161 0.46
162 0.54
163 0.62
164 0.7
165 0.77
166 0.81
167 0.87
168 0.88
169 0.87
170 0.83
171 0.84
172 0.84