Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4SRS6

Protein Details
Accession A0A1E4SRS6    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
124-209EIEGAFKKSKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKKVKKEKKEIKEKKEKVKLSKGKSSQSKSYKVEKPKKARNDBasic
NLS Segment(s)
PositionSequence
130-208KKSKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKKVKKEKKEIKEKKEKVKLSKGKSSQSKSYKVEKPKKARN
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000467  G_patch_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF01585  G-patch  
Amino Acid Sequences MNASGYLQSYGWKEGEALQKHGIKKPILVKHKKDTKGLGHEKNDADMWWERMFDGQLKNLEVNSGSKGVSFESNQQQVIRDVRKATSPLYRMFIKGEGLKGTVEKIDHMTVKEIKVDAAKVILEIEGAFKKSKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKKVKKEKKEIKEKKEKVKLSKGKSSQSKSYKVEKPKKARND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.3
3 0.3
4 0.32
5 0.36
6 0.41
7 0.44
8 0.49
9 0.49
10 0.41
11 0.44
12 0.49
13 0.51
14 0.57
15 0.63
16 0.65
17 0.7
18 0.78
19 0.77
20 0.73
21 0.71
22 0.69
23 0.7
24 0.72
25 0.7
26 0.65
27 0.66
28 0.61
29 0.56
30 0.47
31 0.36
32 0.31
33 0.24
34 0.24
35 0.18
36 0.18
37 0.16
38 0.17
39 0.18
40 0.18
41 0.18
42 0.18
43 0.19
44 0.21
45 0.21
46 0.2
47 0.19
48 0.16
49 0.15
50 0.13
51 0.12
52 0.1
53 0.1
54 0.11
55 0.11
56 0.13
57 0.12
58 0.16
59 0.21
60 0.23
61 0.24
62 0.24
63 0.24
64 0.24
65 0.29
66 0.26
67 0.22
68 0.21
69 0.21
70 0.23
71 0.23
72 0.23
73 0.23
74 0.24
75 0.23
76 0.25
77 0.25
78 0.24
79 0.24
80 0.22
81 0.18
82 0.17
83 0.16
84 0.13
85 0.13
86 0.12
87 0.11
88 0.1
89 0.1
90 0.08
91 0.08
92 0.09
93 0.1
94 0.1
95 0.11
96 0.13
97 0.14
98 0.14
99 0.15
100 0.14
101 0.13
102 0.12
103 0.12
104 0.09
105 0.08
106 0.08
107 0.06
108 0.07
109 0.06
110 0.05
111 0.05
112 0.06
113 0.07
114 0.08
115 0.09
116 0.1
117 0.15
118 0.24
119 0.32
120 0.4
121 0.5
122 0.6
123 0.7
124 0.81
125 0.87
126 0.89
127 0.94
128 0.94
129 0.94
130 0.95
131 0.94
132 0.93
133 0.94
134 0.93
135 0.93
136 0.94
137 0.93
138 0.93
139 0.94
140 0.93
141 0.93
142 0.94
143 0.93
144 0.93
145 0.94
146 0.93
147 0.93
148 0.94
149 0.93
150 0.93
151 0.94
152 0.93
153 0.93
154 0.94
155 0.93
156 0.93
157 0.95
158 0.94
159 0.93
160 0.94
161 0.93
162 0.93
163 0.94
164 0.93
165 0.92
166 0.93
167 0.91
168 0.91
169 0.9
170 0.88
171 0.86
172 0.86
173 0.85
174 0.81
175 0.83
176 0.79
177 0.79
178 0.8
179 0.78
180 0.77
181 0.76
182 0.77
183 0.72
184 0.75
185 0.74
186 0.75
187 0.79
188 0.79
189 0.82