Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4SC54

Protein Details
Accession A0A1E4SC54    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
47-74PFRGPKVLIFWRRRRRARHNRISCMMFMHydrophilic
NLS Segment(s)
PositionSequence
58-64RRRRRAR
Subcellular Location(s) mito 9, cyto_nucl 8.5, cyto 8, nucl 7
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSTAPAHTPAEFAEMTCDCPVSSRVLVGRAMPGHPVFLYVTAIKACPFRGPKVLIFWRRRRRARHNRISCMMFMVRRTRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.17
4 0.17
5 0.13
6 0.14
7 0.15
8 0.15
9 0.15
10 0.14
11 0.15
12 0.16
13 0.17
14 0.16
15 0.18
16 0.14
17 0.14
18 0.15
19 0.14
20 0.12
21 0.11
22 0.12
23 0.09
24 0.09
25 0.1
26 0.07
27 0.08
28 0.08
29 0.08
30 0.08
31 0.08
32 0.08
33 0.12
34 0.15
35 0.16
36 0.21
37 0.24
38 0.25
39 0.32
40 0.41
41 0.45
42 0.51
43 0.6
44 0.65
45 0.73
46 0.79
47 0.8
48 0.83
49 0.85
50 0.88
51 0.89
52 0.88
53 0.87
54 0.87
55 0.81
56 0.7
57 0.64
58 0.57
59 0.48
60 0.42