Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4SH44

Protein Details
Accession A0A1E4SH44    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MPPKRYVDRKESKSRDIKKALTHRARLRKGYBasic
NLS Segment(s)
PositionSequence
10-29KESKSRDIKKALTHRARLRK
63-106RAKIAKQRKEEQRKEKLERVQDRRKAIEKKDKERELKKLRLSQK
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013730  Fyv7/TAP26  
Pfam View protein in Pfam  
PF08524  rRNA_processing  
Amino Acid Sequences MPPKRYVDRKESKSRDIKKALTHRARLRKGYFKLLEQEGESIPEKDVAKSEERAKPTMNYAERAKIAKQRKEEQRKEKLERVQDRRKAIEKKDKERELKKLRLSQKTKTGQPLMGPRINNLLEKIRKDVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.79
4 0.75
5 0.74
6 0.77
7 0.78
8 0.76
9 0.77
10 0.76
11 0.79
12 0.81
13 0.79
14 0.75
15 0.74
16 0.69
17 0.7
18 0.63
19 0.56
20 0.55
21 0.49
22 0.44
23 0.35
24 0.33
25 0.23
26 0.24
27 0.21
28 0.16
29 0.14
30 0.17
31 0.16
32 0.14
33 0.16
34 0.15
35 0.17
36 0.19
37 0.26
38 0.27
39 0.29
40 0.3
41 0.3
42 0.28
43 0.29
44 0.33
45 0.28
46 0.27
47 0.26
48 0.27
49 0.27
50 0.28
51 0.26
52 0.27
53 0.33
54 0.35
55 0.39
56 0.45
57 0.54
58 0.63
59 0.71
60 0.73
61 0.75
62 0.79
63 0.79
64 0.78
65 0.73
66 0.72
67 0.73
68 0.72
69 0.72
70 0.69
71 0.67
72 0.66
73 0.68
74 0.65
75 0.64
76 0.66
77 0.65
78 0.69
79 0.75
80 0.78
81 0.78
82 0.78
83 0.8
84 0.78
85 0.78
86 0.76
87 0.75
88 0.75
89 0.77
90 0.76
91 0.73
92 0.74
93 0.73
94 0.7
95 0.7
96 0.65
97 0.57
98 0.57
99 0.59
100 0.56
101 0.54
102 0.48
103 0.41
104 0.44
105 0.43
106 0.39
107 0.33
108 0.35
109 0.36
110 0.39