Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4SGH7

Protein Details
Accession A0A1E4SGH7   
Localization Confidence High
Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAKSLRSKSKLRAKSVKRKGEFAHydrophilic
81-108STSGWRDSRNQIYKKKHLKKKANKSTNYHydrophilic
NLS Segment(s)
PositionSequence
6-20RSKSKLRAKSVKRKG
94-103KKKHLKKKAN
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRSKSKLRAKSVKRKGEFANFVDGRNKRLSEKMEQELLKQKEAALAKKKDQADAEGAEEPAVPEQDMDVDKTPKKISTSGWRDSRNQIYKKKHLKKKANKSTNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.87
3 0.87
4 0.8
5 0.78
6 0.74
7 0.74
8 0.69
9 0.6
10 0.6
11 0.5
12 0.48
13 0.5
14 0.44
15 0.38
16 0.36
17 0.35
18 0.27
19 0.31
20 0.34
21 0.33
22 0.39
23 0.39
24 0.41
25 0.4
26 0.41
27 0.45
28 0.43
29 0.36
30 0.3
31 0.26
32 0.25
33 0.27
34 0.3
35 0.29
36 0.3
37 0.32
38 0.38
39 0.39
40 0.36
41 0.34
42 0.3
43 0.24
44 0.22
45 0.21
46 0.16
47 0.16
48 0.13
49 0.13
50 0.11
51 0.08
52 0.07
53 0.05
54 0.04
55 0.04
56 0.06
57 0.07
58 0.09
59 0.11
60 0.15
61 0.16
62 0.19
63 0.21
64 0.21
65 0.23
66 0.23
67 0.27
68 0.34
69 0.4
70 0.46
71 0.52
72 0.54
73 0.55
74 0.6
75 0.65
76 0.64
77 0.64
78 0.65
79 0.67
80 0.73
81 0.81
82 0.84
83 0.84
84 0.86
85 0.89
86 0.91
87 0.93
88 0.94