Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4SM10

Protein Details
Accession A0A1E4SM10    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
69-94AEIARIRRARLEKRKRLEERARELGIBasic
NLS Segment(s)
PositionSequence
73-86RIRRARLEKRKRLE
Subcellular Location(s) nucl 10.5, cyto_nucl 9.5, mito 9, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018625  Pet100  
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF09803  Pet100  
Amino Acid Sequences MQQGFYRKFIGGITRTQLETGKFGFYLLTPICIMYYVGLDTDRKFNLPGFWPDPATLNQIPKEPHEIQAEIARIRRARLEKRKRLEERARELGIEEEEEVTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.29
4 0.3
5 0.24
6 0.24
7 0.21
8 0.18
9 0.16
10 0.15
11 0.14
12 0.12
13 0.16
14 0.13
15 0.13
16 0.12
17 0.12
18 0.12
19 0.11
20 0.11
21 0.07
22 0.07
23 0.05
24 0.06
25 0.06
26 0.07
27 0.08
28 0.11
29 0.11
30 0.11
31 0.12
32 0.12
33 0.14
34 0.16
35 0.2
36 0.18
37 0.19
38 0.19
39 0.19
40 0.2
41 0.19
42 0.21
43 0.18
44 0.19
45 0.19
46 0.21
47 0.22
48 0.21
49 0.28
50 0.23
51 0.26
52 0.27
53 0.26
54 0.24
55 0.28
56 0.29
57 0.23
58 0.24
59 0.23
60 0.21
61 0.21
62 0.27
63 0.3
64 0.38
65 0.48
66 0.57
67 0.64
68 0.72
69 0.82
70 0.83
71 0.86
72 0.86
73 0.85
74 0.83
75 0.81
76 0.73
77 0.62
78 0.56
79 0.49
80 0.4
81 0.31
82 0.23