Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4SFQ8

Protein Details
Accession A0A1E4SFQ8   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
56-81NARIRASREKQKRLEQKRKQNEEELYHydrophilic
NLS Segment(s)
PositionSequence
63-69REKQKRL
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MHPQLDKNRFDTCEKLMDALEECHRQEFLKQALGVCNFEKDELSKCLHHTRTNDANARIRASREKQKRLEQKRKQNEEELYGKNGYLKKVIEMDLKAKSEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.34
3 0.28
4 0.27
5 0.25
6 0.23
7 0.25
8 0.21
9 0.21
10 0.21
11 0.21
12 0.2
13 0.19
14 0.22
15 0.2
16 0.22
17 0.22
18 0.22
19 0.27
20 0.28
21 0.28
22 0.23
23 0.22
24 0.17
25 0.16
26 0.15
27 0.12
28 0.14
29 0.14
30 0.16
31 0.16
32 0.18
33 0.25
34 0.27
35 0.3
36 0.29
37 0.33
38 0.37
39 0.42
40 0.43
41 0.4
42 0.43
43 0.4
44 0.41
45 0.35
46 0.3
47 0.32
48 0.33
49 0.39
50 0.43
51 0.51
52 0.55
53 0.64
54 0.72
55 0.77
56 0.83
57 0.83
58 0.85
59 0.87
60 0.89
61 0.84
62 0.82
63 0.74
64 0.69
65 0.66
66 0.58
67 0.51
68 0.42
69 0.37
70 0.35
71 0.34
72 0.29
73 0.26
74 0.23
75 0.23
76 0.26
77 0.29
78 0.3
79 0.31
80 0.34
81 0.36