Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4SD18

Protein Details
Accession A0A1E4SD18    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-38KDLKRELSSVKQPKKRRQKVPQNCHYTRAHydrophilic
NLS Segment(s)
PositionSequence
20-26KQPKKRR
Subcellular Location(s) nucl 13, mito 12
Family & Domain DBs
Amino Acid Sequences MASELRRSDKDLKRELSSVKQPKKRRQKVPQNCHYTRAALRPMAVRLLPLHLVWTGVGGIFHTDRHQARDSLLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.57
3 0.55
4 0.57
5 0.59
6 0.6
7 0.64
8 0.69
9 0.76
10 0.83
11 0.85
12 0.86
13 0.86
14 0.88
15 0.91
16 0.92
17 0.92
18 0.9
19 0.81
20 0.74
21 0.64
22 0.56
23 0.47
24 0.4
25 0.33
26 0.24
27 0.24
28 0.22
29 0.22
30 0.2
31 0.18
32 0.14
33 0.12
34 0.13
35 0.13
36 0.11
37 0.11
38 0.1
39 0.1
40 0.09
41 0.09
42 0.07
43 0.06
44 0.06
45 0.05
46 0.07
47 0.08
48 0.09
49 0.1
50 0.17
51 0.18
52 0.24
53 0.27
54 0.26