Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4SP30

Protein Details
Accession A0A1E4SP30    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
18-40AHAKVLGKRRAARNRKNTASRSTHydrophilic
NLS Segment(s)
PositionSequence
10-33PKNKLHASAHAKVLGKRRAARNRK
Subcellular Location(s) mito 16.5, mito_nucl 14, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MASRNSVNKPKNKLHASAHAKVLGKRRAARNRKNTASRSTVGRYSDADSAAARPTDSKAIALYTGGGPKVTSVMTNTTLSNKRAKKLARNQKYIDQRNNKVKEVEMDVEEKKSQLEKVKAALWTVVENSANLMMSPAGEGTTLGVQAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.69
3 0.7
4 0.66
5 0.62
6 0.57
7 0.55
8 0.53
9 0.55
10 0.51
11 0.49
12 0.51
13 0.57
14 0.62
15 0.7
16 0.76
17 0.77
18 0.81
19 0.84
20 0.86
21 0.8
22 0.76
23 0.72
24 0.64
25 0.59
26 0.52
27 0.47
28 0.4
29 0.37
30 0.32
31 0.28
32 0.28
33 0.23
34 0.19
35 0.16
36 0.15
37 0.15
38 0.13
39 0.1
40 0.09
41 0.1
42 0.12
43 0.12
44 0.11
45 0.1
46 0.1
47 0.1
48 0.09
49 0.09
50 0.07
51 0.08
52 0.08
53 0.07
54 0.06
55 0.06
56 0.07
57 0.06
58 0.06
59 0.06
60 0.08
61 0.1
62 0.11
63 0.12
64 0.16
65 0.18
66 0.2
67 0.27
68 0.27
69 0.26
70 0.31
71 0.35
72 0.4
73 0.48
74 0.57
75 0.59
76 0.64
77 0.65
78 0.68
79 0.75
80 0.73
81 0.72
82 0.7
83 0.69
84 0.71
85 0.73
86 0.67
87 0.58
88 0.51
89 0.44
90 0.4
91 0.35
92 0.26
93 0.26
94 0.24
95 0.26
96 0.25
97 0.21
98 0.17
99 0.17
100 0.19
101 0.23
102 0.27
103 0.27
104 0.3
105 0.34
106 0.33
107 0.33
108 0.3
109 0.23
110 0.2
111 0.19
112 0.19
113 0.15
114 0.14
115 0.14
116 0.14
117 0.13
118 0.11
119 0.1
120 0.07
121 0.07
122 0.08
123 0.06
124 0.06
125 0.06
126 0.06
127 0.07
128 0.08