Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4SPE4

Protein Details
Accession A0A1E4SPE4    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
240-266EFIFPEIRGKKSRKKKDPNRAKLLEGNHydrophilic
NLS Segment(s)
PositionSequence
247-260RGKKSRKKKDPNRA
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR040151  Gfd2/YDR514C-like  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MSYDPQIQRLEIENYINENFKHHPFLNNQGNLKYLAECMRRAYLRWHVLLCIDVEAWEKDNEKVTEIGIALYNPIGQEYALVPNIKQVHIRIEESLRLRNGRYVPDHADYSNSGVSYTMLEEDAVLYLQALVDNYINHPPLSAQGASLVGHNIRGDIAWLDKLGVDFHENLNFIDTEKLFALSNGKQGASLVNGLERVQIPHAYLHNAGNDAYYTLLLAMKLCDPNARRFYNLDFLVTKEFIFPEIRGKKSRKKKDPNRAKLLEGNIDELIIDITRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.3
4 0.25
5 0.25
6 0.26
7 0.27
8 0.32
9 0.3
10 0.34
11 0.36
12 0.46
13 0.52
14 0.54
15 0.54
16 0.49
17 0.48
18 0.44
19 0.4
20 0.31
21 0.24
22 0.25
23 0.25
24 0.25
25 0.27
26 0.31
27 0.31
28 0.32
29 0.35
30 0.37
31 0.4
32 0.42
33 0.4
34 0.34
35 0.34
36 0.33
37 0.27
38 0.19
39 0.13
40 0.11
41 0.12
42 0.12
43 0.13
44 0.14
45 0.15
46 0.15
47 0.21
48 0.21
49 0.2
50 0.2
51 0.18
52 0.18
53 0.17
54 0.16
55 0.11
56 0.1
57 0.09
58 0.08
59 0.09
60 0.06
61 0.06
62 0.06
63 0.05
64 0.06
65 0.07
66 0.09
67 0.11
68 0.12
69 0.11
70 0.16
71 0.18
72 0.18
73 0.18
74 0.16
75 0.2
76 0.23
77 0.24
78 0.22
79 0.22
80 0.26
81 0.27
82 0.3
83 0.26
84 0.25
85 0.24
86 0.27
87 0.27
88 0.26
89 0.27
90 0.27
91 0.29
92 0.3
93 0.31
94 0.26
95 0.26
96 0.22
97 0.21
98 0.18
99 0.13
100 0.11
101 0.1
102 0.1
103 0.08
104 0.08
105 0.06
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.04
112 0.04
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.04
120 0.04
121 0.06
122 0.08
123 0.09
124 0.08
125 0.08
126 0.08
127 0.08
128 0.11
129 0.09
130 0.07
131 0.07
132 0.08
133 0.09
134 0.09
135 0.08
136 0.06
137 0.06
138 0.06
139 0.06
140 0.05
141 0.05
142 0.05
143 0.05
144 0.06
145 0.05
146 0.05
147 0.05
148 0.06
149 0.06
150 0.06
151 0.06
152 0.07
153 0.08
154 0.09
155 0.11
156 0.11
157 0.11
158 0.12
159 0.11
160 0.1
161 0.12
162 0.11
163 0.1
164 0.1
165 0.11
166 0.1
167 0.1
168 0.14
169 0.12
170 0.16
171 0.15
172 0.15
173 0.14
174 0.15
175 0.15
176 0.12
177 0.12
178 0.09
179 0.08
180 0.09
181 0.09
182 0.11
183 0.1
184 0.1
185 0.11
186 0.11
187 0.12
188 0.14
189 0.15
190 0.16
191 0.17
192 0.18
193 0.17
194 0.18
195 0.17
196 0.14
197 0.13
198 0.11
199 0.09
200 0.07
201 0.06
202 0.06
203 0.06
204 0.06
205 0.06
206 0.07
207 0.1
208 0.11
209 0.11
210 0.17
211 0.19
212 0.28
213 0.35
214 0.37
215 0.36
216 0.37
217 0.41
218 0.44
219 0.42
220 0.37
221 0.3
222 0.3
223 0.32
224 0.3
225 0.26
226 0.19
227 0.18
228 0.17
229 0.18
230 0.17
231 0.23
232 0.29
233 0.34
234 0.41
235 0.48
236 0.56
237 0.65
238 0.76
239 0.76
240 0.81
241 0.87
242 0.9
243 0.95
244 0.95
245 0.95
246 0.88
247 0.83
248 0.78
249 0.73
250 0.69
251 0.59
252 0.52
253 0.41
254 0.36
255 0.3
256 0.24
257 0.19