Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4SL35

Protein Details
Accession A0A1E4SL35    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
118-144NSEIGKKTQSKRSKSRRARGSITKQETHydrophilic
NLS Segment(s)
PositionSequence
124-136KTQSKRSKSRRAR
Subcellular Location(s) nucl 16, cyto_nucl 13, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR038291  SAP30_C_sf  
IPR025718  SAP30_Sin3-bd  
Pfam View protein in Pfam  
PF13867  SAP30_Sin3_bdg  
Amino Acid Sequences MNLSWLTPDAIITSTQITTAESASESESYKHYGSLGVGASGISQTSSTKSSQKAKTQAALQAQQMYLSKHINSNGPQDKPKVNPLEFEEYDDETLARYNQKYGLGLPPITTINSDILNSEIGKKTQSKRSKSRRARGSITKQETSNHIKAHFLNLPCKENEIITSFLYKVRHQDSDFKLTFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.11
5 0.1
6 0.1
7 0.1
8 0.08
9 0.09
10 0.1
11 0.12
12 0.12
13 0.12
14 0.14
15 0.16
16 0.16
17 0.16
18 0.14
19 0.14
20 0.13
21 0.15
22 0.14
23 0.11
24 0.1
25 0.1
26 0.09
27 0.08
28 0.08
29 0.04
30 0.05
31 0.05
32 0.07
33 0.09
34 0.11
35 0.16
36 0.21
37 0.3
38 0.36
39 0.43
40 0.49
41 0.51
42 0.53
43 0.52
44 0.51
45 0.48
46 0.44
47 0.38
48 0.33
49 0.29
50 0.27
51 0.25
52 0.2
53 0.17
54 0.16
55 0.15
56 0.14
57 0.16
58 0.18
59 0.19
60 0.27
61 0.3
62 0.31
63 0.33
64 0.34
65 0.35
66 0.34
67 0.39
68 0.37
69 0.31
70 0.31
71 0.33
72 0.38
73 0.34
74 0.35
75 0.3
76 0.24
77 0.24
78 0.21
79 0.17
80 0.09
81 0.09
82 0.08
83 0.08
84 0.07
85 0.08
86 0.1
87 0.11
88 0.11
89 0.12
90 0.15
91 0.15
92 0.15
93 0.15
94 0.15
95 0.14
96 0.14
97 0.13
98 0.1
99 0.09
100 0.1
101 0.09
102 0.08
103 0.08
104 0.09
105 0.09
106 0.11
107 0.11
108 0.11
109 0.13
110 0.19
111 0.23
112 0.32
113 0.41
114 0.46
115 0.56
116 0.66
117 0.75
118 0.81
119 0.85
120 0.85
121 0.84
122 0.84
123 0.84
124 0.83
125 0.82
126 0.79
127 0.73
128 0.64
129 0.59
130 0.57
131 0.55
132 0.49
133 0.42
134 0.36
135 0.35
136 0.35
137 0.39
138 0.39
139 0.33
140 0.36
141 0.38
142 0.41
143 0.39
144 0.41
145 0.35
146 0.3
147 0.29
148 0.25
149 0.22
150 0.2
151 0.22
152 0.19
153 0.22
154 0.24
155 0.23
156 0.27
157 0.3
158 0.36
159 0.36
160 0.45
161 0.48
162 0.55