Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4SMY6

Protein Details
Accession A0A1E4SMY6   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
39-70AKTKDIKPAERPKKTFNKKKPLNKKPATLAAKHydrophilic
NLS Segment(s)
PositionSequence
42-65KDIKPAERPKKTFNKKKPLNKKPA
105-150PRGPPRTPRTPRAPGVRTARGPRPPRSDAPAPSAARPAPQRQARPT
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 9, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MYNSVKAPLRRVGLRFQSSDSKNSVFLSDLFKRIEEVTAKTKDIKPAERPKKTFNKKKPLNKKPATLAAKPAPQQPQNVIKVQDHSLMNSFGQSYAQFATTGGAPRGPPRTPRTPRAPGVRTARGPRPPRSDAPAPSAARPAPQRQARPTRQRALDTSEKDGKVPSKKLVAQPLVPQLGGNTFFYGKLTTVNPCVTSRVASITKEALLKSKYPYLAPKHIIDHLPEGPQNKFLLQNNYSLEVDQDAFTSRFNEVVKGTPQQINVGVKGAQAEFTRAEIMKNGTLNVANKQTLFDIVNGLKSPKDLFANAAWAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.54
3 0.52
4 0.56
5 0.53
6 0.54
7 0.49
8 0.41
9 0.37
10 0.36
11 0.33
12 0.25
13 0.24
14 0.27
15 0.27
16 0.29
17 0.28
18 0.27
19 0.28
20 0.27
21 0.3
22 0.25
23 0.26
24 0.3
25 0.32
26 0.34
27 0.38
28 0.41
29 0.44
30 0.47
31 0.5
32 0.52
33 0.59
34 0.68
35 0.73
36 0.74
37 0.75
38 0.8
39 0.84
40 0.85
41 0.84
42 0.85
43 0.85
44 0.91
45 0.93
46 0.93
47 0.93
48 0.89
49 0.86
50 0.82
51 0.82
52 0.77
53 0.68
54 0.65
55 0.6
56 0.58
57 0.53
58 0.52
59 0.49
60 0.45
61 0.46
62 0.44
63 0.47
64 0.45
65 0.47
66 0.44
67 0.38
68 0.39
69 0.38
70 0.38
71 0.29
72 0.26
73 0.24
74 0.23
75 0.21
76 0.18
77 0.16
78 0.11
79 0.11
80 0.1
81 0.09
82 0.09
83 0.09
84 0.09
85 0.08
86 0.09
87 0.1
88 0.12
89 0.1
90 0.11
91 0.11
92 0.14
93 0.18
94 0.19
95 0.24
96 0.29
97 0.39
98 0.44
99 0.51
100 0.56
101 0.59
102 0.64
103 0.67
104 0.63
105 0.59
106 0.61
107 0.59
108 0.55
109 0.53
110 0.53
111 0.53
112 0.56
113 0.55
114 0.56
115 0.54
116 0.53
117 0.54
118 0.54
119 0.48
120 0.48
121 0.48
122 0.42
123 0.38
124 0.38
125 0.31
126 0.28
127 0.29
128 0.26
129 0.27
130 0.31
131 0.34
132 0.39
133 0.49
134 0.55
135 0.62
136 0.65
137 0.65
138 0.63
139 0.61
140 0.56
141 0.52
142 0.51
143 0.42
144 0.41
145 0.39
146 0.36
147 0.34
148 0.33
149 0.32
150 0.29
151 0.29
152 0.26
153 0.26
154 0.29
155 0.33
156 0.39
157 0.36
158 0.33
159 0.34
160 0.36
161 0.32
162 0.28
163 0.24
164 0.17
165 0.17
166 0.16
167 0.13
168 0.09
169 0.09
170 0.09
171 0.09
172 0.1
173 0.08
174 0.09
175 0.1
176 0.11
177 0.13
178 0.14
179 0.16
180 0.16
181 0.18
182 0.16
183 0.16
184 0.15
185 0.17
186 0.18
187 0.16
188 0.18
189 0.17
190 0.18
191 0.19
192 0.18
193 0.18
194 0.18
195 0.19
196 0.2
197 0.24
198 0.23
199 0.23
200 0.31
201 0.33
202 0.39
203 0.4
204 0.4
205 0.38
206 0.41
207 0.4
208 0.35
209 0.33
210 0.27
211 0.26
212 0.26
213 0.26
214 0.23
215 0.24
216 0.23
217 0.19
218 0.22
219 0.23
220 0.29
221 0.28
222 0.32
223 0.31
224 0.34
225 0.33
226 0.28
227 0.25
228 0.18
229 0.18
230 0.13
231 0.12
232 0.11
233 0.11
234 0.12
235 0.13
236 0.11
237 0.14
238 0.14
239 0.16
240 0.14
241 0.18
242 0.21
243 0.23
244 0.27
245 0.27
246 0.27
247 0.27
248 0.31
249 0.3
250 0.27
251 0.26
252 0.22
253 0.19
254 0.21
255 0.19
256 0.17
257 0.14
258 0.16
259 0.15
260 0.15
261 0.18
262 0.17
263 0.17
264 0.17
265 0.21
266 0.22
267 0.22
268 0.21
269 0.2
270 0.23
271 0.25
272 0.27
273 0.28
274 0.26
275 0.25
276 0.26
277 0.25
278 0.24
279 0.24
280 0.19
281 0.2
282 0.2
283 0.23
284 0.23
285 0.23
286 0.21
287 0.21
288 0.22
289 0.2
290 0.23
291 0.2
292 0.23
293 0.24
294 0.33