Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4SJX7

Protein Details
Accession A0A1E4SJX7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
129-153VPFTRIFKRKPKAPKVEVKDSVKKVHydrophilic
NLS Segment(s)
PositionSequence
136-158KRKPKAPKVEVKDSVKKVEKPRL
Subcellular Location(s) plas 18, E.R. 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018811  Mrx11  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF10306  FLILHELTA  
Amino Acid Sequences MNSHPILKRVPKFLRPFALRFIHAPISHVTAFLILHELTAIIPLIGVWYVLHKYHLSIPMDLPSWAIDKGTKVIDSSMARFDFTGWNVNEKFTFMMEGAYAFVIVKFLLPVRLMISLGLMPWFSKWVVVPFTRIFKRKPKAPKVEVKDSVKKVEKPRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.67
3 0.65
4 0.63
5 0.6
6 0.53
7 0.47
8 0.45
9 0.41
10 0.36
11 0.35
12 0.29
13 0.29
14 0.27
15 0.25
16 0.2
17 0.14
18 0.14
19 0.12
20 0.13
21 0.08
22 0.07
23 0.07
24 0.07
25 0.06
26 0.07
27 0.06
28 0.04
29 0.03
30 0.03
31 0.04
32 0.04
33 0.04
34 0.03
35 0.05
36 0.06
37 0.07
38 0.09
39 0.09
40 0.1
41 0.14
42 0.2
43 0.2
44 0.2
45 0.2
46 0.21
47 0.21
48 0.2
49 0.16
50 0.11
51 0.11
52 0.1
53 0.09
54 0.08
55 0.08
56 0.09
57 0.1
58 0.09
59 0.08
60 0.09
61 0.13
62 0.13
63 0.14
64 0.15
65 0.15
66 0.15
67 0.14
68 0.15
69 0.12
70 0.12
71 0.17
72 0.14
73 0.18
74 0.18
75 0.19
76 0.18
77 0.17
78 0.16
79 0.1
80 0.11
81 0.07
82 0.07
83 0.06
84 0.06
85 0.06
86 0.05
87 0.05
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.06
96 0.06
97 0.07
98 0.08
99 0.09
100 0.09
101 0.09
102 0.09
103 0.08
104 0.08
105 0.08
106 0.06
107 0.06
108 0.06
109 0.08
110 0.07
111 0.08
112 0.08
113 0.12
114 0.16
115 0.17
116 0.22
117 0.24
118 0.32
119 0.38
120 0.41
121 0.43
122 0.48
123 0.56
124 0.6
125 0.68
126 0.7
127 0.74
128 0.8
129 0.85
130 0.83
131 0.86
132 0.86
133 0.84
134 0.83
135 0.76
136 0.76
137 0.74
138 0.72